PD1 (PDCD1) (NM_005018) Human Recombinant Protein
CAT#: TP310364
Recombinant protein of human programmed cell death 1 (PDCD1), 20 µg
USD 447.00
USD 471.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210364 protein sequence
Red=Cloning site Green=Tags(s) MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRM SPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRA ELRVTERRAEVPTAHPSPSPRPAGQFQTLVVGVVGGLLGSLVLLVWVLAVICSRAARGTIGARRTGQPLK EDPSAVPVFSVDYGELDFQWREKTPEPPVPCVPEQTEYATIVFPSGMGTSSPARRGSADGPRSAQPLRPE DGHCSWPL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 29.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005009 |
Locus ID | 5133 |
UniProt ID | Q15116, A0A0M3M0G7 |
Cytogenetics | 2q37.3 |
Refseq Size | 2115 |
Refseq ORF | 864 |
Synonyms | CD279; hPD-1; hPD-l; hSLE1; PD-1; PD1; SLEB2 |
Summary | Programmed cell death protein 1 (PDCD1) is an immune-inhibitory receptor expressed in activated T cells; it is involved in the regulation of T-cell functions, including those of effector CD8+ T cells. In addition, this protein can also promote the differentiation of CD4+ T cells into T regulatory cells. PDCD1 is expressed in many types of tumors including melanomas, and has demonstrated to play a role in anti-tumor immunity. Moreover, this protein has been shown to be involved in safeguarding against autoimmunity, however, it can also contribute to the inhibition of effective anti-tumor and anti-microbial immunity. [provided by RefSeq, Aug 2020] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Cell adhesion molecules (CAMs), T cell receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401555 | PDCD1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY401555 | Transient overexpression lysate of programmed cell death 1 (PD-1 / PDCD1) |
USD 436.00 |
|
PH310364 | PD-1 / PDCD1 MS Standard C13 and N15-labeled recombinant protein (NP_005009) |
USD 3,255.00 |
|
TP700198 | Purified recombinant protein of Homo sapiens programmed cell death 1 (PDCD1), 25-167aa, with C-terminal DDK/His tag, expressed in HEK293 cells. |
USD 867.00 |
|
TP700199 | Purified recombinant protein of Homo sapiens programmed cell death 1 (PD1/PDCD1), residues 25-167aa, with C-terminal Fc tag, expressed in HEK293 cells. |
USD 867.00 |
|
TP721292 | Human PD1 Protein (C-His) |
USD 258.00 |
|
TP721293 | Human PD1 Protein (C-His-Avi) |
USD 258.00 |
|
TP721294 | Biotinylated Human PD1 Protein (C-His-Avi) |
USD 366.00 |
|
TP721295 | PE Conjugated Human PD1 Protein (C-His) |
USD 366.00 |
|
TP721296 | APC Conjugated Human PD1 Protein (C-His) |
USD 366.00 |
|
TP721297 | Human PD1 Protein (C-Fc) |
USD 258.00 |
|
TP721298 | Human PD1 Protein (C-Fc-Avi) |
USD 258.00 |
|
TP721299 | Biotinylated Human PD1 Protein (C-Fc-Avi) |
USD 366.00 |
|
TP721300 | PE Conjugated Human PD1 Protein (C-Fc) |
USD 366.00 |
|
TP721301 | APC Conjugated Human PD1 Protein (C-Fc) |
USD 366.00 |
|
TP723948 | Human PD-1 Protein, mFc-His tag |
USD 572.00 |
|
TP723998 | Human PD-1 Protein, His tag |
USD 493.00 |
|
TP723999 | Human PD-1 Protein, hFc-His tag |
USD 546.00 |
{0} Product Review(s)
Be the first one to submit a review