PD1 (PDCD1) (NM_005018) Human Mass Spec Standard

SKU
PH310364
PD-1 / PDCD1 MS Standard C13 and N15-labeled recombinant protein (NP_005009)
  $3,360.00
3 Weeks*
Bulk/Customize
Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC210364
Predicted MW 31.6 kDa
Protein Sequence
Protein Sequence
>RC210364 protein sequence
Red=Cloning site Green=Tags(s)

MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRM
SPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRA
ELRVTERRAEVPTAHPSPSPRPAGQFQTLVVGVVGGLLGSLVLLVWVLAVICSRAARGTIGARRTGQPLK
EDPSAVPVFSVDYGELDFQWREKTPEPPVPCVPEQTEYATIVFPSGMGTSSPARRGSADGPRSAQPLRPE
DGHCSWPL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005009
RefSeq Size 2115
RefSeq ORF 864
Synonyms CD279; hPD-1; hPD-l; hSLE1; PD-1; PD1; SLEB2
Locus ID 5133
UniProt ID Q15116
Cytogenetics 2q37.3
Summary Programmed cell death protein 1 (PDCD1) is an immune-inhibitory receptor expressed in activated T cells; it is involved in the regulation of T-cell functions, including those of effector CD8+ T cells. In addition, this protein can also promote the differentiation of CD4+ T cells into T regulatory cells. PDCD1 is expressed in many types of tumors including melanomas, and has demonstrated to play a role in anti-tumor immunity. Moreover, this protein has been shown to be involved in safeguarding against autoimmunity, however, it can also contribute to the inhibition of effective anti-tumor and anti-microbial immunity. provided by RefSeq, Aug 2020
Protein Families Druggable Genome, Transmembrane
Protein Pathways Cell adhesion molecules (CAMs), T cell receptor signaling pathway
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PD1" proteins (18)
SKU Description Size Price
LC401555 Lyophilized PDCD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401555 Transient overexpression lysate of programmed cell death 1 (PD-1 / PDCD1) (as WB positive control) 100 ug
$436.00
TP310364 Recombinant protein of human programmed cell death 1 (PDCD1), 20 µg 20 ug
$737.00
TP700198 Purified recombinant protein of Homo sapiens programmed cell death 1 (PDCD1), 25-167aa, with C-terminal DDK/His tag, expressed in HEK293 cells. 20 ug
$900.00
TP700199 Purified recombinant protein of Homo sapiens programmed cell death 1 (PD1/PDCD1), residues 25-167aa, with C-terminal Fc tag, expressed in HEK293 cells. 20 ug
$900.00
TP721292 Human PD1 Protein (C-His) 25 ug
$300.00
TP721293 Human PD1 Protein (C-His-Avi) 25 ug
$300.00
TP721294 Biotinylated Human PD1 Protein (C-His-Avi) 25 ug
$430.00
TP721295 PE Conjugated Human PD1 Protein (C-His) 25 ug
$430.00
TP721296 APC Conjugated Human PD1 Protein (C-His) 25 ug
$430.00
TP721297 Human PD1 Protein (C-Fc) 25 ug
$300.00
TP721298 Human PD1 Protein (C-Fc-Avi) 25 ug
$300.00
TP721299 Biotinylated Human PD1 Protein (C-Fc-Avi) 25 ug
$430.00
TP721300 PE Conjugated Human PD1 Protein (C-Fc) 25 ug
$430.00
TP721301 APC Conjugated Human PD1 Protein (C-Fc) 25 ug
$430.00
TP723948 Recombinant human PD-1 protein with C-terminal mouse Fc and 6×His tag 100 ug
$905.00
TP723998 Recombinant human PD-1 protein with C-terminal 6×His tag 100 ug
$695.00
TP723999 Recombinant human PD-1 protein with C-terminal human Fc and 6×His tag 100 ug
$905.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products