OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

gag (NC_001802) Virus Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
VC101718
Myc-DDK-tagged ORF clone of viral ORF for Pr55(Gag) [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_057850
$289.00 $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (3)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00

Other products for "gag or NC_001802"

Specifications
Specifications
Product Data
Type Virus Tagged ORF Clone
Target Symbol gag
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>The Viral ORF clone VC101718 represents NCBI reference of NP_057850 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s)

GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGTGCTAGAGCCTCTGTGTTGAGTGGCGGGGAGTTGGATCGGTGGGAGAAGATTCGACTGCGGCCTG
GGGGTAAAAAGAAGTACAAGCTGAAGCACATCGTGTGGGCTTCAAGGGAGCTTGAGCGCTTCGCGGTCAA
TCCCGGACTGCTGGAGACGAGCGAAGGATGCCGCCAGATCCTCGGACAGCTGCAGCCCTCCCTGCAGACA
GGTTCTGAGGAGCTCAGGAGCCTGTACAACACAGTGGCAACCCTGTATTGCGTTCACCAGAGAATCGAGA
TCAAAGATACCAAGGAGGCCCTCGATAAGATCGAGGAGGAGCAAAACAAGTCTAAGAAGAAGGCTCAACA
GGCCGCCGCGGACACTGGGCACAGCAACCAGGTTTCCCAAAATTATCCCATCGTGCAGAACATCCAGGGG
CAGATGGTCCACCAGGCTATCTCCCCGCGAACCCTTAATGCCTGGGTTAAAGTTGTGGAGGAAAAGGCTT
TTTCCCCTGAAGTGATACCTATGTTCTCCGCCTTGAGTGAAGGCGCCACTCCGCAGGACCTCAATACCAT
GCTCAATACAGTGGGCGGGCATCAGGCCGCTATGCAGATGCTTAAAGAAACCATCAACGAGGAGGCAGCA
GAATGGGACCGAGTGCACCCAGTGCACGCTGGTCCAATAGCACCTGGACAAATGCGGGAACCCCGGGGCT
CAGATATTGCCGGCACGACATCAACCCTCCAAGAGCAGATCGGATGGATGACTAATAACCCCCCTATTCC
CGTGGGAGAAATATATAAGAGATGGATAATCCTGGGCCTGAACAAAATAGTCAGAATGTACTCACCTACT
AGTATCCTGGACATTAGGCAAGGACCAAAGGAGCCCTTCAGAGATTACGTAGACAGATTCTATAAGACCC
TTCGGGCTGAACAGGCTTCCCAGGAGGTCAAGAATTGGATGACCGAGACCCTTCTCGTGCAAAACGCAAA
TCCGGACTGTAAAACCATTCTGAAGGCTCTCGGTCCCGCAGCTACCCTCGAAGAGATGATGACAGCCTGC
CAGGGCGTCGGTGGTCCGGGACACAAGGCCCGGGTTCTCGCTGAGGCCATGAGCCAGGTCACTAATAGCG
CCACCATCATGATGCAGCGGGGTAACTTCCGCAACCAGAGGAAAATCGTCAAATGTTTCAACTGTGGAAA
GGAAGGCCACACAGCGCGGAACTGCCGCGCTCCAAGGAAGAAAGGCTGCTGGAAGTGCGGCAAGGAGGGG
CATCAGATGAAAGACTGCACAGAACGGCAGGCTAATTTCCTGGGAAAGATCTGGCCATCTTATAAGGGAA
GACCCGGCAACTTCCTTCAATCAAGACCTGAACCGACCGCACCACCCGAAGAGAGCTTCAGAAGTGGCGT
AGAAACCACCACTCCTCCTCAGAAGCAGGAACCAATTGACAAAGAGCTCTATCCTTTGACAAGCTTGCGC
TCTCTGTTCGGAAATGATCCAAGCAGTCAG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>VC101718 representing NP_057850
Red=Cloning sites Green=Tags

MGARASVLSGGELDRWEKIRLRPGGKKKYKLKHIVWASRELERFAVNPGLLETSEGCRQILGQLQPSLQT
GSEELRSLYNTVATLYCVHQRIEIKDTKEALDKIEEEQNKSKKKAQQAAADTGHSNQVSQNYPIVQNIQG
QMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAA
EWDRVHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRMYSPT
SILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPAATLEEMMTAC
QGVGGPGHKARVLAEAMSQVTNSATIMMQRGNFRNQRKIVKCFNCGKEGHTARNCRAPRKKGCWKCGKEG
HQMKDCTERQANFLGKIWPSYKGRPGNFLQSRPEPTAPPEESFRSGVETTTPPQKQEPIDKELYPLTSLR
SLFGNDPSSQ

TRTRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene |
ACCN NC_001802
ORF Size 1500 bp
OTI Disclaimer The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NC_001802.1, NP_057850
RefSeq ORF 1500 bp
Locus ID 155030
UniProt ID P04585
MW 55.9 kDa
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NC_001802" in other vectors (19)
SKU Description Size Price
VC101716 Myc-DDK-tagged ORF clone of viral ORF for Tat [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_057853 10 ug
$289.00
VC101717 Myc-DDK-tagged ORF clone of viral ORF for Rev [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_057854 10 ug
$289.00
VC101719 Myc-DDK-tagged ORF clone of viral ORF for Vif [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_057851 10 ug
$289.00 $300.00
VC101720 Myc-DDK-tagged ORF clone of viral ORF for Vpr [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_057852 10 ug
$289.00
VC101721 Myc-DDK-tagged ORF clone of viral ORF for Envelope surface glycoprotein gp160, precursor [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_057856 10 ug
$589.00 $784.00
VC101722 Myc-DDK-tagged ORF clone of viral ORF for Nef [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_057857 10 ug
$289.00 $300.00
VC101723 Myc-DDK-tagged ORF clone of viral ORF for Vpu [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_057855 10 ug
$289.00
VC101724 Myc-DDK-tagged ORF clone of viral ORF for matrix [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_579876 10 ug
$225.00
VC101725 Myc-DDK-tagged ORF clone of viral ORF for capsid [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_579880 10 ug
$450.00
VC101726 Myc-DDK-tagged ORF clone of viral ORF for nucleocapsid [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_579881 10 ug
$225.00
VC101727 Myc-DDK-tagged ORF clone of viral ORF for p2 [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_579882 10 ug
$289.00
VC101728 Myc-DDK-tagged ORF clone of viral ORF for p6 [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_579883 10 ug
$225.00
VC101729 Myc-DDK-tagged ORF clone of viral ORF for unnamed protein product [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_579893 10 ug
$289.00
VC101730 Myc-DDK-tagged ORF clone of viral ORF for Envelope transmembrane glycoprotein gp41 [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_579895 10 ug
$289.00 $457.00
VC101732 Myc-DDK-tagged ORF clone of viral ORF for retropepsin [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_705926 10 ug
$225.00
VC101735 Myc-DDK-tagged ORF clone of viral ORF for p1 [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_787042 10 ug
$289.00
VC101736 Myc-DDK-tagged ORF clone of viral ORF for Gag-Pol Transframe peptide [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_787043 10 ug
$289.00
VC101737 Myc-DDK-tagged ORF clone of viral ORF for reverse transcriptase p51 subunit [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_789739 10 ug
$289.00 $457.00
VC101739 Myc-DDK-tagged ORF clone of viral ORF for Envelope surface glycoprotein gp120 [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_579894 10 ug
$289.00 $457.00

file-alt Citations

Multivalent display of membrane proteins using HIV-1 Gag VLPs
Bhat, Dunn, Yu et al
Frontiers in Drug Discovery (2026) 5 DOI: 10.3389/fddsv.2025.1688204
Cited by 1
AI Summary: OriGene’s Gag polyprotein (VC101718) was used for transient transfection to produce HIV-1 Gag VLPs, enabling the display and study of membrane proteins in their native conformation for antibody discovery.
Snippet: The cells were transiently transfected with the Gag polyprotein (OriGene, VC101718) using polyethyleneimine (PEI). To determine an ideal time-point for harvesting VLPs
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products