vpu (NC_001802) Virus Tagged ORF Clone

SKU
VC101723
Myc-DDK-tagged ORF clone of viral ORF for Vpu [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_057855
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00
In Stock*
Specifications
Product Data
Type Virus Tagged ORF Clone
Target Symbol vpu
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>The Viral ORF clone VC101723 represents NCBI reference of NP_057855 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s)

GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGCCTATCCCAATAGTGGCTATTGTGGCACTGGTGGTGGCCATCATCATAGCCATCGTCGTGTGGA
GTATTGTTATAATCGAGTATCGCAAGATTCTGCGACAGCGGAAGATAGATCGGCTGATCGATCGGTTGAT
TGAGCGCGCCGAAGATTCCGGCAATGAATCCGAAGGGGAAATTTCAGCCCTGGTCGAGATGGGAGTCGAA
ATGGGGCATCATGCCCCCTGGGATGTCGACGACCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>VC101723 representing NP_057855
Red=Cloning sites Green=Tags

MQPIPIVAIVALVVAIIIAIVVWSIVIIEYRKILRQRKIDRLIDRLIERAEDSGNESEGEISALVEMGVE
MGHHAPWDVDDL

TRTRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene
ACCN NC_001802
ORF Size 246 bp
OTI Disclaimer The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NC_001802.1, NP_057855
RefSeq ORF 246 bp
Locus ID 155945
UniProt ID P04585
MW 9.2 kDa
Write Your Own Review
You're reviewing:vpu (NC_001802) Virus Tagged ORF Clone
Your Rating
SKU Description Size Price
VC101716 Myc-DDK-tagged ORF clone of viral ORF for Tat [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_057853 10 ug
$289.00
VC101717 Myc-DDK-tagged ORF clone of viral ORF for Rev [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_057854 10 ug
$289.00
VC101718 Myc-DDK-tagged ORF clone of viral ORF for Pr55(Gag) [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_057850 10 ug
$289.00 MSRP $457.00 MSRP $457.00
VC101719 Myc-DDK-tagged ORF clone of viral ORF for Vif [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_057851 10 ug
$289.00 MSRP $300.00 MSRP $300.00
VC101720 Myc-DDK-tagged ORF clone of viral ORF for Vpr [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_057852 10 ug
$289.00
VC101721 Myc-DDK-tagged ORF clone of viral ORF for Envelope surface glycoprotein gp160, precursor [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_057856 10 ug
$589.00 MSRP $784.00 MSRP $784.00
VC101722 Myc-DDK-tagged ORF clone of viral ORF for Nef [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_057857 10 ug
$289.00 MSRP $300.00 MSRP $300.00
VC101724 Myc-DDK-tagged ORF clone of viral ORF for matrix [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_579876 10 ug
$225.00
VC101725 Myc-DDK-tagged ORF clone of viral ORF for capsid [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_579880 10 ug
$450.00
VC101726 Myc-DDK-tagged ORF clone of viral ORF for nucleocapsid [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_579881 10 ug
$225.00
VC101727 Myc-DDK-tagged ORF clone of viral ORF for p2 [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_579882 10 ug
$289.00
VC101728 Myc-DDK-tagged ORF clone of viral ORF for p6 [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_579883 10 ug
$225.00
VC101729 Myc-DDK-tagged ORF clone of viral ORF for unnamed protein product [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_579893 10 ug
$289.00
VC101730 Myc-DDK-tagged ORF clone of viral ORF for Envelope transmembrane glycoprotein gp41 [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_579895 10 ug
$289.00 MSRP $457.00 MSRP $457.00
VC101732 Myc-DDK-tagged ORF clone of viral ORF for retropepsin [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_705926 10 ug
$225.00
VC101735 Myc-DDK-tagged ORF clone of viral ORF for p1 [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_787042 10 ug
$289.00
VC101736 Myc-DDK-tagged ORF clone of viral ORF for Gag-Pol Transframe peptide [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_787043 10 ug
$289.00
VC101737 Myc-DDK-tagged ORF clone of viral ORF for reverse transcriptase p51 subunit [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_789739 10 ug
$289.00 MSRP $457.00 MSRP $457.00
VC101739 Myc-DDK-tagged ORF clone of viral ORF for Envelope surface glycoprotein gp120 [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_579894 10 ug
$289.00 MSRP $457.00 MSRP $457.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.