OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

p53 (TP53) (NM_001126114) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP325502
Purified recombinant protein of Homo sapiens tumor protein p53 (TP53), transcript variant 3, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA502870 TP53 mouse monoclonal antibody, clone OTI5E2 (formerly 5E2) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "p53 or NM_001126114"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC225502 representing NM_001126114
Red=Cloning site Green=Tags(s)

MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAA
PPVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKT
CPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRN
TFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGR
DRRTEEENLRKKGEPHHELPPGSTKRALPNNTSSSPQPKKKPLDGEYFTLQDQTSFQKENC

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 37.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001119586
Locus ID 7157
UniProt ID P04637
Cytogenetics 17p13.1
RefSeq ORF 1023
Synonyms BCC7; BMFS5; LFS1; P53; TRP53
Summary This gene encodes a tumor suppressor protein containing transcriptional activation, DNA binding, and oligomerization domains. The encoded protein responds to diverse cellular stresses to regulate expression of target genes, thereby inducing cell cycle arrest, apoptosis, senescence, DNA repair, or changes in metabolism. Mutations in this gene are associated with a variety of human cancers, including hereditary cancers such as Li-Fraumeni syndrome. Alternative splicing of this gene and the use of alternate promoters result in multiple transcript variants and isoforms. Additional isoforms have also been shown to result from the use of alternate translation initiation codons from identical transcript variants (PMIDs: 12032546, 20937277). provided by RefSeq, Dec 2016
Protein Categories ADC Targets, Cancer: Bladder, Cancer: Brain and CNS, Cancer: Endocrine, Cancer: Gastrointestinal, Cancer: Gynecologic, Cancer: Haematopoietic and Lymphoid, Cancer: Head and Neck, Cancer: Lung, Cancer: Sarcoma, Cancer: Skin, Cardiovascular diseases, Growth Factors, Intracellular Proteins, Nervous system Diseases, Transciption Factors
Protein Families Druggable Genome, Stem cell - Pluripotency, Transcription Factors
Protein Pathways Amyotrophic lateral sclerosis (ALS), Apoptosis, Basal cell carcinoma, Bladder cancer, Cell cycle, Chronic myeloid leukemia, Colorectal cancer, Endometrial cancer, Glioma, Huntington's disease, MAPK signaling pathway, Melanoma, Neurotrophin signaling pathway, Non-small cell lung cancer, p53 signaling pathway, Pancreatic cancer, Pathways in cancer, Prostate cancer, Small cell lung cancer, Thyroid cancer, Wnt signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "p53" proteins (16)
SKU Description Size Price
PH300003 TP53 MS Standard C13 and N15-labeled recombinant protein (NP_000537) 10 ug
$3,360.00
PH325502 TP53 MS Standard C13 and N15-labeled recombinant protein (NP_001119586) 10 ug
$3,360.00
PH325604 TP53 MS Standard C13 and N15-labeled recombinant protein (NP_001119584) 10 ug
$3,360.00
LC400186 Lyophilized TP53 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426652 Lyophilized TP53 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426653 Lyophilized TP53 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426654 Lyophilized TP53 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400186 Transient overexpression lysate of tumor protein p53 (TP53), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY426652 Transient overexpression lysate of tumor protein p53 (TP53), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY426653 Transient overexpression lysate of tumor protein p53 (TP53), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY426654 Transient overexpression lysate of tumor protein p53 (TP53), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP300003 Recombinant protein of human tumor protein p53 (TP53), transcript variant 1, 20 µg 20 ug
$867.00
TP325604 Recombinant protein of human tumor protein p53 (TP53), transcript variant 2, 20 µg 20 ug
$867.00
TP701001 Purified recombinant protein of human tumor protein P53 (TP53), transcript variant 1, mutant (Y220C), expressed in HEK293 cells, 20ug 20 ug
$900.00
TP710022 Recombinant protein of human tumor protein p53 (TP53), transcript variant 1, full length, with C-terminal DDK tag, expressed in sf9 cells. 20 ug
$540.00
TP750119 Purified recombinant protein of Human tumor protein p53 (TP53), transcript variant 1, full length, N-terminal His and GST tag, expressed in E. coli, 50ug 50 ug
$270.00

file-alt Citations

Zinc shapes the folding landscape of p53 and establishes a pathway for reactivating structurally diverse cancer mutants
Blanden, Yu, Blayney et al
Elife (2020) 9 DOI: 10.7554/eLife.61487
AI Summary: OriGene contributed to this study by providing the initial plasmid containing the human TP53 R273H mutant, which was used in experiments investigating the effects of zinc on p53 folding and mutant reactivation.
Snippet: The initial plasmid with human TP53 R273H mutant was purchased from OriGene
FigureFigureFigure
Brother of regulator of imprinted sites inhibits cisplatin-induced DNA damage in non-small cell lung cancer
Zhang, Song, Li et al
Oncol Lett (2020) 20 (5), 251 DOI: 10.3892/ol.2020.12114
Cited by 10
AI Summary: OriGene products contributed to this study by providing the pBORIS plasmids used for BORIS overexpression and the Flag antibody (cat. no. R1180B) for detecting Flag-tagged proteins, enabling the authors to investigate the role of BORIS in cisplatin resistance in non-small cell lung cancer.
Snippet: Lipofectamine 3000 reagent (Thermo Fisher Scientific, Inc.) was used to transfect pBORIS plasmids purchased from OriGene Technologies Inc Flag antibody (cat. no. R1180B) was purchased from OriGene Technologies, Inc. FITC conjugated rabbit antibody (cat;- Lipofectamine 3000 reagent (Thermo Fisher Scientific, Inc.) was used to transfect pBORIS plasmids purchased from OriGene Technologies Inc Flag antibody (cat. no. R1180B) was purchased from OriGene Technologies, Inc. …
FigureFigureFigure
Arecoline N-oxide regulates oral squamous cell carcinoma development through NOTCH1 and FAT1 expressions
Kuo, Nithiyanantham, Lee et al
J. Cell. Physiol. (2019)
AI Summary: OriGene products contributed to this study by providing the NOTCH1, FAT1, and TP53 primers used for gene expression analysis.
Snippet: The NOTCH1, FAT1, and TP53 primers were obtained from OriGene (OriGene Technologies Inc, Rockville, MD). 2.5 Western blot analysis. The cell lysate preparation and western blotting protocols were performed as previously described (Kuo et al., 2015)
The miR-644a/CTBP1/p53 axis suppresses drug resistance by simultaneous inhibition of cell survival and epithelial-mesenchymal transition in breast cancer
Raza, Saatci, Uhlmann et al
Oncotarget (2016) 7 (31), 49859-49877 DOI: 10.18632/oncotarget.10489
Snippet: 50 ng (for 96-well experiments) or 500 ng (for 6-well experiments) per well of GFP tagged CTBP1 (NM_001012614;Cat. … RG208594) human ORF Clone and Myc-DDK tagged TP53 (NM_000546;Cat. … RC200003) human mutant ORF Clone vector were purchased from Origene and used for overexpression and rescue experiments. Latter one expresses transcript variant 1 of Homo sapiens protein p53 having an R175H mutation
FigureFigureFigure
Species-specific mutual regulation of p53 and miR-138 between human, rat and mouse
Li, Xia, Su et al
Sci Rep (2016) 6, 26187 DOI: 10.1038/srep26187
Cited by 13
AI Summary: OriGene products, including recombinant p53 protein and pCMV/p63 and pCMV/p73 plasmids, were used in this study to investigate the species-specific regulatory interactions between p53 and miR-138.
Snippet: Primer sequences used for ChIP are listed in Table S1. EMSA. Recombinant p53 protein was purchased from OriGene (OriGene Technologies, Rockville, MD, USA). ... pCMV/p63 and pCMV/p73 were all purchased from OriGene (OriGene Technologies, Rockville, MD ... Cite SaveSaving
Combined CSL and p53 downregulation promotes cancer-associated fibroblast activation
Procopio, Laszlo, Al Labban et al
Nat Cell Biol (2015) 17 (9), 1193-204 DOI: 10.1038/ncb3228
Cited by 222
AI Summary: In this study, OriGene’s p53 shRNA lentiviral particles (OriGene, TL311088V) were used to specifically downregulate p53 expression in fibroblasts, enabling the researchers to investigate the combined effects of CSL and p53 loss on cancer-associated fibroblast activation.
FigureFigureFigure
Showing 1-6 of 9 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products