OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ASCL1 (NM_004316) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RG201123
ASCL1 (tGFP-tagged) - Human achaete-scute complex homolog 1 (Drosophila) (ASCL1)
ORF Plasmid:
tGFP DDK
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$489.00 $500.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA321640 Anti-ASCL1 Rabbit Polyclonal Antibody
100 ul
$305.00
TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8 100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "ASCL1 or NM_004316"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ASCL1
Synonyms ASH1; bHLHa46; HASH1; MASH1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG201123 representing NM_004316
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAAAGCTCTGCCAAGATGGAGAGCGGCGGCGCCGGCCAGCAGCCCCAGCCGCAGCCCCAGCAGCCCT
TCCTGCCGCCCGCAGCCTGTTTCTTTGCCACGGCCGCAGCCGCGGCGGCCGCAGCCGCCGCAGCGGCAGC
GCAGAGCGCGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGGCGCCGCAGCTGAGACCGGCGGCC
GACGGCCAGCCCTCAGGGGGCGGTCACAAGTCAGCGCCCAAGCAAGTCAAGCGACAGCGCTCGTCTTCGC
CCGAACTGATGCGCTGCAAACGCCGGCTCAACTTCAGCGGCTTTGGCTACAGCCTGCCGCAGCAGCAGCC
GGCCGCCGTGGCGCGCCGCAACGAGCGCGAGCGCAACCGCGTCAAGTTGGTCAACCTGGGCTTTGCCACC
CTTCGGGAGCACGTCCCCAACGGCGCGGCCAACAAGAAGATGAGTAAGGTGGAGACACTGCGCTCGGCGG
TCGAGTACATCCGCGCGCTGCAGCAGCTGCTGGACGAGCATGACGCGGTGAGCGCCGCCTTCCAGGCAGG
CGTCCTGTCGCCCACCATCTCCCCCAACTACTCCAACGACTTGAACTCCATGGCCGGCTCGCCGGTCTCA
TCCTACTCGTCGGACGAGGGCTCTTACGACCCGCTCAGCCCCGAGGAGCAGGAGCTTCTCGACTTCACCA
ACTGGTTC

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG201123 representing NM_004316
Red=Cloning site Green=Tags(s)

MESSAKMESGGAGQQPQPQPQQPFLPPAACFFATAAAAAAAAAAAAAQSAQQQQQQQQQQQQAPQLRPAA
DGQPSGGGHKSAPKQVKRQRSSSPELMRCKRRLNFSGFGYSLPQQQPAAVARRNERERNRVKLVNLGFAT
LREHVPNGAANKKMSKVETLRSAVEYIRALQQLLDEHDAVSAAFQAGVLSPTISPNYSNDLNSMAGSPVS
SYSSDEGSYDPLSPEEQELLDFTNWF

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_004316
ORF Size 708 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004316.4
RefSeq Size 2482 bp
RefSeq ORF 711 bp
Locus ID 429
UniProt ID P50553
Cytogenetics 12q23.2
Domains HLH
Protein Families Druggable Genome, Transcription Factors
Summary This gene encodes a member of the basic helix-loop-helix (BHLH) family of transcription factors. The protein activates transcription by binding to the E box (5'-CANNTG-3'). Dimerization with other BHLH proteins is required for efficient DNA binding. This protein plays a role in the neuronal commitment and differentiation and in the generation of olfactory and autonomic neurons. Mutations in this gene may contribute to the congenital central hypoventilation syndrome (CCHS) phenotype in rare cases. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_004316" in other vectors (7)
SKU Description Size Price
RC201123 ASCL1 (Myc-DDK-tagged)-Human achaete-scute complex homolog 1 (Drosophila) (ASCL1) 10 ug
$300.00
RC201123L1 Lenti ORF clone of Human achaete-scute complex homolog 1 (Drosophila) (ASCL1), Myc-DDK-tagged 10 ug
$600.00
RC201123L2 Lenti ORF clone of Human achaete-scute complex homolog 1 (Drosophila) (ASCL1), mGFP tagged 10 ug
$600.00
RC201123L3 Lenti ORF clone of Human achaete-scute complex homolog 1 (Drosophila) (ASCL1), Myc-DDK-tagged 10 ug
$600.00
RC201123L4 Lenti ORF clone of Human achaete-scute complex homolog 1 (Drosophila) (ASCL1), mGFP tagged 10 ug
$600.00
SC117427 ASCL1 (untagged)-Human achaete-scute complex homolog 1 (Drosophila) (ASCL1) 10 ug
$300.00
SC324383 ASCL1 (untagged)-Human achaete-scute complex homolog 1 (Drosophila) (ASCL1) 10 ug
$300.00

Plasmid Map for RG201123

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RG201123
Circular map for RG201123

file-alt Citations

Pharmacological inhibition of the Janus Kinases enhances ASCL1 protein stability and transcriptional activity
Hanspal, Presland, Shkura et al
Mol Biol Rep (2025) 52 (1), 299 DOI: 10.1007/s11033-025-10367-9
AI Summary: OriGene’s human pCMV6-ASCL1-tGFP plasmid (RG201123) was used to transfect cells and generate ASCL1-overexpressing cell lines, enabling the study of how Janus kinase inhibition affects ASCL1 protein stability and transcriptional activity.
Snippet: dified environment containing 5% CO2. For transient transfections, SH-SY5Y cells were transfected with pmaxGFP (Lonza, UK) and HEK 293 cells were transfected with human pCMV6-ASCL1-tGFP (RG201123, OriGene, UK) using Lipofectamine 2000 according to the manufacturer’s instructions. To generate stable ASCL1-overexpressing SH-SY5Ys (ASCL1-5Ys), SH-SY5Y cells were transfected with human pCMV6-ASCL
FigureFigureFigure
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products