M-CSF (CSF1) (NM_172211) Human Recombinant Protein

  • Product Brand Image
SKU
TP317172
Recombinant protein of human colony stimulating factor 1 (macrophage) (CSF1), transcript variant 3, 20 µg
  $737.00
In Stock*
Bulk/Customize
Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC217172 representing NM_172211
Red=Cloning site Green=Tags(s)

MTAPGAAGRCPPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFV
DQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYE
TPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQGHERQSEGSSSPQLQESVFHLLVPSVILV
LLAVGGLLFYRWRRRSHQEPQRADSPLEQPEGSPLTQDDRQVELPV

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 29 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_757350
Locus ID 1435
UniProt ID P09603
Cytogenetics 1p13.3
RefSeq Size 1855
RefSeq ORF 768
Synonyms CSF-1; MCSF
Summary The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of macrophages. The active form of the protein is found extracellularly as a disulfide-linked homodimer, and is thought to be produced by proteolytic cleavage of membrane-bound precursors. The encoded protein may be involved in development of the placenta. Alternate splicing results in multiple transcript variants. provided by RefSeq, Sep 2011
Protein Categories Cytokines, Growth Factors, Intracellular Proteins, Membrane Proteins, Secreated Proteins
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein, Transmembrane
Protein Pathways Cytokine-cytokine receptor interaction, Hematopoietic cell lineage
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
Other "M-CSF" proteins (19)
SKU Description Size Price
PH305855 CSF1 MS Standard C13 and N15-labeled recombinant protein (NP_757351) 10 ug
$3,360.00
PH313103 CSF1 MS Standard C13 and N15-labeled recombinant protein (NP_757349) 10 ug
$3,360.00
PH317104 CSF1 MS Standard C13 and N15-labeled recombinant protein (NP_000748) 10 ug
$3,360.00
PH317172 CSF1 MS Standard C13 and N15-labeled recombinant protein (NP_757350) 10 ug
$3,360.00
LC403534 Lyophilized CSF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC406741 Lyophilized CSF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC406742 Lyophilized CSF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424534 Lyophilized CSF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC430359 Lyophilized CSF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403534 Transient overexpression lysate of colony stimulating factor 1 (macrophage) (CSF1), transcript variant 2 (as WB positive control) 100 ug
$665.00
LY406741 Transient overexpression lysate of colony stimulating factor 1 (macrophage) (CSF1), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY406742 Transient overexpression lysate of colony stimulating factor 1 (macrophage) (CSF1), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY424534 Transient overexpression lysate of colony stimulating factor 1 (macrophage) (CSF1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY430359 Transient overexpression lysate of colony stimulating factor 1 (macrophage) (CSF1), transcript variant 4 (as WB positive control) 100 ug
$436.00
TP305855 Recombinant protein of human colony stimulating factor 1 (macrophage) (CSF1), transcript variant 4, 20 µg 20 ug
$737.00
TP313103 Recombinant protein of human colony stimulating factor 1 (macrophage) (CSF1), transcript variant 2, 20 µg 20 ug
$737.00
TP317104 Recombinant protein of human colony stimulating factor 1 (macrophage) (CSF1), transcript variant 1, 20 µg 20 ug
$737.00
TP720352 Recombinant protein of human colony stimulating factor 1 (macrophage) (CSF1), transcript variant 1 10 ug
$340.00
TP723739 Purified recombinant protein of Human colony stimulating factor 1 (macrophage) (CSF1), transcript variant 4 10 ug
$290.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products