OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

M-CSF (CSF1) (NM_172211) Human Mass Spec Standard

Be the first to review this product
SKU
PH317172
CSF1 MS Standard C13 and N15-labeled recombinant protein (NP_757350)
Size:
10 ug
  $3,360.00
2 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA806568 CSF1 mouse monoclonal antibody, clone OTI2D6 (formerly 2D6) 100 ul
$447.00
LY403534 Transient overexpression lysate of colony stimulating factor 1 (macrophage) (CSF1), transcript variant 2 (as WB positive control) 100 ug
$665.00

Other products for "M-CSF or NM_172211"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC217172
Predicted MW 29 kDa
Protein Sequence
Protein Sequence
>RC217172 representing NM_172211
Red=Cloning site Green=Tags(s)

MTAPGAAGRCPPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFV
DQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYE
TPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQGHERQSEGSSSPQLQESVFHLLVPSVILV
LLAVGGLLFYRWRRRSHQEPQRADSPLEQPEGSPLTQDDRQVELPV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_757350
RefSeq Size 1855
RefSeq ORF 768
Synonyms CSF-1; MCSF
Locus ID 1435
UniProt ID P09603
Cytogenetics 1p13.3
Summary The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of macrophages. The active form of the protein is found extracellularly as a disulfide-linked homodimer, and is thought to be produced by proteolytic cleavage of membrane-bound precursors. The encoded protein may be involved in development of the placenta. Alternate splicing results in multiple transcript variants. provided by RefSeq, Sep 2011
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein, Transmembrane
Protein Pathways Cytokine-cytokine receptor interaction, Hematopoietic cell lineage
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "M-CSF" proteins (19)
SKU Description Size Price
PH305855 CSF1 MS Standard C13 and N15-labeled recombinant protein (NP_757351) 10 ug
$3,360.00
PH313103 CSF1 MS Standard C13 and N15-labeled recombinant protein (NP_757349) 10 ug
$3,360.00
PH317104 CSF1 MS Standard C13 and N15-labeled recombinant protein (NP_000748) 10 ug
$3,360.00
LC403534 Lyophilized CSF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC406741 Lyophilized CSF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC406742 Lyophilized CSF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424534 Lyophilized CSF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC430359 Lyophilized CSF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403534 Transient overexpression lysate of colony stimulating factor 1 (macrophage) (CSF1), transcript variant 2 (as WB positive control) 100 ug
$665.00
LY406741 Transient overexpression lysate of colony stimulating factor 1 (macrophage) (CSF1), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY406742 Transient overexpression lysate of colony stimulating factor 1 (macrophage) (CSF1), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY424534 Transient overexpression lysate of colony stimulating factor 1 (macrophage) (CSF1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY430359 Transient overexpression lysate of colony stimulating factor 1 (macrophage) (CSF1), transcript variant 4 (as WB positive control) 100 ug
$436.00
TP305855 Recombinant protein of human colony stimulating factor 1 (macrophage) (CSF1), transcript variant 4, 20 µg 20 ug
$737.00
TP313103 Recombinant protein of human colony stimulating factor 1 (macrophage) (CSF1), transcript variant 2, 20 µg 20 ug
$737.00
TP317104 Recombinant protein of human colony stimulating factor 1 (macrophage) (CSF1), transcript variant 1, 20 µg 20 ug
$737.00
TP317172 Recombinant protein of human colony stimulating factor 1 (macrophage) (CSF1), transcript variant 3, 20 µg 20 ug
$737.00
TP720352 Recombinant protein of human colony stimulating factor 1 (macrophage) (CSF1), transcript variant 1 10 ug
$340.00
TP723739 Purified recombinant protein of Human colony stimulating factor 1 (macrophage) (CSF1), transcript variant 4 10 ug
$290.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products