M-CSF (CSF1) (NM_172210) Human Mass Spec Standard

SKU
PH313103
CSF1 MS Standard C13 and N15-labeled recombinant protein (NP_757349)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC213103]
Predicted MW 47.7 kDa
Protein Sequence
Protein Sequence
>RC213103 representing NM_172210
Red=Cloning site Green=Tags(s)

MTAPGAAGRCPPTTWLGSLLLLVCLLASRSITEEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFV
DQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYE
TPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCNCLYPKAIPSSDPASVSPHQP
LAPSMAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRPPRSTCQSFEPPETPVVKDSTIGGSPQP
RPSVGAFNPGMEDILDSAMGTNWVPEEASGEASEIPVPQGTELSPSRPGGGSMQTEPARPSNFLSASSPL
PASAKGQQPADVTGHERQSEGSSSPQLQESVFHLLVPSVILVLLAVGGLLFYRWRRRSHQEPQRADSPLE
QPEGSPLTQDDRQVELPV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_757349
RefSeq Size 1519
RefSeq ORF 1314
Synonyms CSF-1; MCSF
Locus ID 1435
UniProt ID P09603
Cytogenetics 1p13.3
Summary The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of macrophages. The active form of the protein is found extracellularly as a disulfide-linked homodimer, and is thought to be produced by proteolytic cleavage of membrane-bound precursors. The encoded protein may be involved in development of the placenta. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2011]
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein, Transmembrane
Protein Pathways Cytokine-cytokine receptor interaction, Hematopoietic cell lineage
Write Your Own Review
You're reviewing:M-CSF (CSF1) (NM_172210) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH305855 CSF1 MS Standard C13 and N15-labeled recombinant protein (NP_757351) 10 ug
$3,255.00
PH317104 CSF1 MS Standard C13 and N15-labeled recombinant protein (NP_000748) 10 ug
$3,255.00
PH317172 CSF1 MS Standard C13 and N15-labeled recombinant protein (NP_757350) 10 ug
$3,255.00
LC403534 CSF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC406741 CSF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC406742 CSF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424534 CSF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC430359 CSF1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403534 Transient overexpression lysate of colony stimulating factor 1 (macrophage) (CSF1), transcript variant 2 100 ug
$665.00
LY406741 Transient overexpression lysate of colony stimulating factor 1 (macrophage) (CSF1), transcript variant 3 100 ug
$436.00
LY406742 Transient overexpression lysate of colony stimulating factor 1 (macrophage) (CSF1), transcript variant 4 100 ug
$436.00
LY424534 Transient overexpression lysate of colony stimulating factor 1 (macrophage) (CSF1), transcript variant 1 100 ug
$436.00
LY430359 Transient overexpression lysate of colony stimulating factor 1 (macrophage) (CSF1), transcript variant 4 100 ug
$436.00
TP305855 Recombinant protein of human colony stimulating factor 1 (macrophage) (CSF1), transcript variant 4, 20 µg 20 ug
$737.00
TP313103 Recombinant protein of human colony stimulating factor 1 (macrophage) (CSF1), transcript variant 2, 20 µg 20 ug
$737.00
TP317104 Recombinant protein of human colony stimulating factor 1 (macrophage) (CSF1), transcript variant 1, 20 µg 20 ug
$737.00
TP317172 Recombinant protein of human colony stimulating factor 1 (macrophage) (CSF1), transcript variant 3, 20 µg 20 ug
$737.00
TP720352 Recombinant protein of human colony stimulating factor 1 (macrophage) (CSF1), transcript variant 1 10 ug
$330.00
TP723739 Purified recombinant protein of Human colony stimulating factor 1 (macrophage) (CSF1), transcript variant 4 10 ug
$290.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.