OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

KAT5 (NM_182710) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP315979
Recombinant protein of human K(lysine) acetyltransferase 5 (KAT5), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "KAT5 or NM_182710"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC215979 representing NM_182710
Red=Cloning site Green=Tags(s)

MAEVVSPVPGAGRREPGEVGRARGPPVADPGVALSPQGEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDI
SGRKLFYVHYIDFNKRLDEWVTHERLDLKKIQFPKKEAKTPTKNGLPGSRPGSPEREVPASAQASGKTLP
IPVQITLRFNLPKEREAIPGGEPDQPLSSSSCLQPNHRSTKRKVEVVSPATPVPSETAPASVFPQNGAAR
RAVAAQPGRKRKSNCLGTDEDSQDSSDGIPSAPRMTGSLVSDRSHDDIVTRMKNIECIELGRHRLKPWYF
SPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHLTKCDLRHPPGNEIYRKGTISFFEIDGRKNKSYSQNLC
LLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIE
FSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEILMGLKSESGERPQITINEISEITSIKKEDVIS
TLQYLNLINYYKGQYILTLSEDIVDGHERAMLKRLLRIDSKCLHFTPKDWSKRGKW

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 61.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_874369
Locus ID 10524
UniProt ID Q92993
Cytogenetics 11q13.1
RefSeq Size 2335
RefSeq ORF 1638
Synonyms cPLA2; ESA1; HTATIP; HTATIP1; NEDFASB; PLIP; TIP; TIP60; ZC2HC5
Summary The protein encoded by this gene belongs to the MYST family of histone acetyl transferases (HATs) and was originally isolated as an HIV-1 TAT-interactive protein. HATs play important roles in regulating chromatin remodeling, transcription and other nuclear processes by acetylating histone and nonhistone proteins. This protein is a histone acetylase that has a role in DNA repair and apoptosis and is thought to play an important role in signal transduction. Alternative splicing of this gene results in multiple transcript variants. provided by RefSeq, Jul 2008
Protein Categories Intracellular Proteins, Transciption Factors
Protein Families Druggable Genome, Transcription Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "KAT5" proteins (11)
SKU Description Size Price
PH309059 KAT5 MS Standard C13 and N15-labeled recombinant protein (NP_006379) 10 ug
$3,360.00
PH310591 KAT5 MS Standard C13 and N15-labeled recombinant protein (NP_874368) 10 ug
$3,360.00
PH315979 KAT5 MS Standard C13 and N15-labeled recombinant protein (NP_874369) 10 ug
$3,360.00
LC401920 Lyophilized KAT5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC405422 Lyophilized KAT5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC405423 Lyophilized KAT5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401920 Transient overexpression lysate of K(lysine) acetyltransferase 5 (KAT5), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY405422 Transient overexpression lysate of K(lysine) acetyltransferase 5 (KAT5), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY405423 Transient overexpression lysate of K(lysine) acetyltransferase 5 (KAT5), transcript variant 1 (as WB positive control) 100 ug
$665.00
TP309059 Recombinant protein of human K(lysine) acetyltransferase 5 (KAT5), transcript variant 2, 20 µg 20 ug
$867.00
TP310591 Recombinant protein of human K(lysine) acetyltransferase 5 (KAT5), transcript variant 3, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products