KAT5 (NM_182709) Human Mass Spec Standard

SKU
PH310591
KAT5 MS Standard C13 and N15-labeled recombinant protein (NP_874368)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC210591]
Predicted MW 53.1 kDa
Protein Sequence
Protein Sequence
>RC210591 protein sequence
Red=Cloning site Green=Tags(s)

MAEVGEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDISGRKLFYVHYIDFNKRLDEWVTHERLDLKKIQF
PKKEAKTPTKNGLPGSRPGSPEREVKRKVEVVSPATPVPSETAPASVFPQNGAARRAVAAQPGRKRKSNC
LGTDEDSQDSSDGIPSAPRMTGSLVSDRSHDDIVTRMKNIECIELGRHRLKPWYFSPYPQELTTLPVLYL
CEFCLKYGRSLKCLQRHLTKCDLRHPPGNEIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYD
TDPFLFYVMTEYDCKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTP
EKPLSDLGLLSYRSYWSQTILEILMGLKSESGERPQITINEISEITSIKKEDVISTLQYLNLINYYKGQY
ILTLSEDIVDGHERAMLKRLLRIDSKCLHFTPKDWSKRGKW

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_874368
RefSeq Size 2092
RefSeq ORF 1383
Synonyms cPLA2; ESA1; HTATIP; HTATIP1; NEDFASB; PLIP; TIP; TIP60; ZC2HC5
Locus ID 10524
UniProt ID Q92993
Cytogenetics 11q13.1
Summary The protein encoded by this gene belongs to the MYST family of histone acetyl transferases (HATs) and was originally isolated as an HIV-1 TAT-interactive protein. HATs play important roles in regulating chromatin remodeling, transcription and other nuclear processes by acetylating histone and nonhistone proteins. This protein is a histone acetylase that has a role in DNA repair and apoptosis and is thought to play an important role in signal transduction. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Transcription Factors
Write Your Own Review
You're reviewing:KAT5 (NM_182709) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH309059 KAT5 MS Standard C13 and N15-labeled recombinant protein (NP_006379) 10 ug
$3,255.00
PH315979 KAT5 MS Standard C13 and N15-labeled recombinant protein (NP_874369) 10 ug
$3,255.00
LC401920 KAT5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC405422 KAT5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC405423 KAT5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401920 Transient overexpression lysate of K(lysine) acetyltransferase 5 (KAT5), transcript variant 2 100 ug
$436.00
LY405422 Transient overexpression lysate of K(lysine) acetyltransferase 5 (KAT5), transcript variant 3 100 ug
$436.00
LY405423 Transient overexpression lysate of K(lysine) acetyltransferase 5 (KAT5), transcript variant 1 100 ug
$665.00
TP309059 Recombinant protein of human K(lysine) acetyltransferase 5 (KAT5), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP310591 Recombinant protein of human K(lysine) acetyltransferase 5 (KAT5), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP315979 Recombinant protein of human K(lysine) acetyltransferase 5 (KAT5), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.