KAT5 (NM_006388) Human Recombinant Protein

SKU
TP309059
Recombinant protein of human K(lysine) acetyltransferase 5 (KAT5), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC209059 protein sequence
Red=Cloning site Green=Tags(s)

MAEVGEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDISGRKLFYVHYIDFNKRLDEWVTHERLDLKKIQF
PKKEAKTPTKNGLPGSRPGSPEREVPASAQASGKTLPIPVQITLRFNLPKEREAIPGGEPDQPLSSSSCL
QPNHRSTKRKVEVVSPATPVPSETAPASVFPQNGAARRAVAAQPGRKRKSNCLGTDEDSQDSSDGIPSAP
RMTGSLVSDRSHDDIVTRMKNIECIELGRHRLKPWYFSPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHL
TKCDLRHPPGNEIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFH
IVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQ
TILEILMGLKSESGERPQITINEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDIVDGHERAMLK
RLLRIDSKCLHFTPKDWSKRGKW

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 58.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_006379
Locus ID 10524
UniProt ID Q92993
Cytogenetics 11q13.1
RefSeq Size 2248
RefSeq ORF 1539
Synonyms cPLA2; ESA1; HTATIP; HTATIP1; NEDFASB; PLIP; TIP; TIP60; ZC2HC5
Summary The protein encoded by this gene belongs to the MYST family of histone acetyl transferases (HATs) and was originally isolated as an HIV-1 TAT-interactive protein. HATs play important roles in regulating chromatin remodeling, transcription and other nuclear processes by acetylating histone and nonhistone proteins. This protein is a histone acetylase that has a role in DNA repair and apoptosis and is thought to play an important role in signal transduction. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Transcription Factors
Write Your Own Review
You're reviewing:KAT5 (NM_006388) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH309059 KAT5 MS Standard C13 and N15-labeled recombinant protein (NP_006379) 10 ug
$3,255.00
PH310591 KAT5 MS Standard C13 and N15-labeled recombinant protein (NP_874368) 10 ug
$3,255.00
PH315979 KAT5 MS Standard C13 and N15-labeled recombinant protein (NP_874369) 10 ug
$3,255.00
LC401920 KAT5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC405422 KAT5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC405423 KAT5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401920 Transient overexpression lysate of K(lysine) acetyltransferase 5 (KAT5), transcript variant 2 100 ug
$436.00
LY405422 Transient overexpression lysate of K(lysine) acetyltransferase 5 (KAT5), transcript variant 3 100 ug
$436.00
LY405423 Transient overexpression lysate of K(lysine) acetyltransferase 5 (KAT5), transcript variant 1 100 ug
$665.00
TP310591 Recombinant protein of human K(lysine) acetyltransferase 5 (KAT5), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP315979 Recombinant protein of human K(lysine) acetyltransferase 5 (KAT5), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.