OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CEACAM19 (NM_020219) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP315862
Recombinant protein of human carcinoembryonic antigen-related cell adhesion molecule 19 (CEACAM19), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA338409 Rabbit Polyclonal Anti-CEACAM19 Antibody
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "CEACAM19 or NM_020219"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC215862 representing NM_020219
Red=Cloning site Green=Tags(s)

MEIPMGTQGCFSKSLLLSASILVLWMLQGSQAALYIQKIPEQPQKNQDLLLSVQGVPDTFQDFNWYLGEE
TYGGTRLFTYIPGIQRPQRDGSAMGQRDIVGFPNGSMLLRRAQPTDSGTYQVAITINSEWTMKAKTEVQV
AEKNKELPSTHLPTNAGILAATIIGSLAAGALLISCIAYLLVTRNWRGQSHRLPAPRGQGSLSILCSAVS
PVPSVTPSTWMATTEKPELGPAHDAGDNNIYEVMPSPVLLVSPISDTRSINPARPLPTPPHLQAEPENHQ
YQQDLLNPDPAPYCQLVPTS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 32.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_064604
Locus ID 56971
UniProt ID Q7Z692
Cytogenetics 19q13.31
RefSeq Size 1863
RefSeq ORF 900
Synonyms CEACM19; CEAL1
Protein Categories Intracellular Proteins, Membrane Proteins
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CEACAM19" proteins (7)
SKU Description Size Price
PH315862 CEACAM19 MS Standard C13 and N15-labeled recombinant protein (NP_064604) 10 ug
$3,360.00
PH325416 CEACAM19 MS Standard C13 and N15-labeled recombinant protein (NP_001121365) 10 ug
$3,360.00
LC412583 Lyophilized CEACAM19 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426880 Lyophilized CEACAM19 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412583 Transient overexpression lysate of carcinoembryonic antigen-related cell adhesion molecule 19 (CEACAM19), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY426880 Transient overexpression lysate of carcinoembryonic antigen-related cell adhesion molecule 19 (CEACAM19), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP325416 Recombinant protein of human carcinoembryonic antigen-related cell adhesion molecule 19 (CEACAM19), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products