CEACAM19 (NM_001127893) Human Mass Spec Standard

SKU
PH325416
CEACAM19 MS Standard C13 and N15-labeled recombinant protein (NP_001121365)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC225416]
Predicted MW 32.3 kDa
Protein Sequence
Protein Sequence
>RC225416 representing NM_001127893
Red=Cloning site Green=Tags(s)

MEIPMGTQGCFSKSLLLSASILVLWMLQGSQAALYIQKIPEQPQKNQDLLLSVQGVPDTFQDFNWYLGEE
TYGGTRLFTYIPGIQRPQRDGSAMGQRDIVGFPNGSMLLRRAQPTDSGTYQVAITINSEWTMKAKTEVQV
AEKNKELPSTHLPTNAGILAATIIGSLAAGALLISCIAYLLVTRNWRGQSHRLPAPRGQGSLSILCSAVS
PVPSVTPSTWMATTEKPELGPAHDAGDNNIYEVMPSPVLLVSPISDTRSINPARPLPTPPHLQAEPENHQ
YQDLLNPDPAPYCQLVPTS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001121365
RefSeq ORF 897
Synonyms CEACM19; CEAL1
Locus ID 56971
UniProt ID Q7Z692
Cytogenetics 19q13.31
Protein Families Transmembrane
Write Your Own Review
You're reviewing:CEACAM19 (NM_001127893) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH315862 CEACAM19 MS Standard C13 and N15-labeled recombinant protein (NP_064604) 10 ug
$3,255.00
LC412583 CEACAM19 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC426880 CEACAM19 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY412583 Transient overexpression lysate of carcinoembryonic antigen-related cell adhesion molecule 19 (CEACAM19), transcript variant 2 100 ug
$436.00
LY426880 Transient overexpression lysate of carcinoembryonic antigen-related cell adhesion molecule 19 (CEACAM19), transcript variant 1 100 ug
$436.00
TP315862 Recombinant protein of human carcinoembryonic antigen-related cell adhesion molecule 19 (CEACAM19), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP325416 Recombinant protein of human carcinoembryonic antigen-related cell adhesion molecule 19 (CEACAM19), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.