OriGene Logo

CEACAM19 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA338409
Rabbit Polyclonal Anti-CEACAM19 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY412583 Transient overexpression lysate of carcinoembryonic antigen-related cell adhesion molecule 19 (CEACAM19), transcript variant 2 100 ug
$436.00
TP325416 Recombinant protein of human carcinoembryonic antigen-related cell adhesion molecule 19 (CEACAM19), transcript variant 1, 20 µg
20 ug
$867.00

View other "CEACAM19 or NM_020219" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CEACAM19 antibody: synthetic peptide directed towards the middle region of human CEACAM19. Synthetic peptide located within the following region: MLLRRAQPTDSGTYQVAITINSEWTMKAKTEVQVAEKNKELPSTHLPTNA
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 33 kDa
Gene Name carcinoembryonic antigen related cell adhesion molecule 19
Database Link
Background The specific function of the protein remains unknown.
Synonyms CEACM19; CEAL1
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Categories Intracellular Proteins, Membrane Proteins
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.