OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HOMER2 (NM_199331) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP314311
Purified recombinant protein of Homo sapiens homer homolog 2 (Drosophila) (HOMER2), transcript variant 3, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA806246 HOMER2 mouse monoclonal antibody, clone OTI1D1 (formerly 1D1) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "HOMER2 or NM_199331"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC214311 representing NM_199331
Red=Cloning site Green=Tags(s)

MGEQPIFTTRAHVFQIDPNTKKNWMPASKQAVTVSYFYDVTRNSYRIISVDGAKVIINSTITPNMTFTKT
SQKFGQWADSRANTVFGLGFSSEQQLTKFAEKFQEVKEAAKIAKDKTQEKIETSSNHSQASSVNGTDDEK
ASHAGPANTHLKSENDKLKIALTQSAANVKNEINREKEKNTQLKRRIEELEAELREKETELKDLRKQSEI
IPQLMSECEYVSEKLEAAERDNQNLEDKVRSLKTDIEESKYRQRHLKVELKSFLEVLDGKIDDLHDFRRG
LSKLGTDN

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 32.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_955363
Locus ID 9455
UniProt ID Q9NSB8
Cytogenetics 15q25.2
RefSeq Size 1807
RefSeq ORF 864
Synonyms ACPD; CPD; HOMER-2; HOMER2A; HOMER2B; Vesl-2
Summary This gene encodes a member of the homer family of dendritic proteins. Members of this family regulate group 1 metabotrophic glutamate receptor function. The encoded protein is a postsynaptic density scaffolding protein. Alternative splicing results in multiple transcript variants. Two related pseudogenes have been identified on chromosome 14. provided by RefSeq, Jun 2011
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "HOMER2" proteins (15)
SKU Description Size Price
PH304165 HOMER2 MS Standard C13 and N15-labeled recombinant protein (NP_004830) 10 ug
$3,360.00
PH314311 HOMER2 MS Standard C13 and N15-labeled recombinant protein (NP_955363) 10 ug
$3,360.00
PH318155 HOMER2 MS Standard C13 and N15-labeled recombinant protein (NP_955364) 10 ug
$3,360.00
PH323154 HOMER2 MS Standard C13 and N15-labeled recombinant protein (NP_955362) 10 ug
$3,360.00
LC401516 Lyophilized HOMER2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404625 Lyophilized HOMER2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404626 Lyophilized HOMER2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC404627 Lyophilized HOMER2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401516 Transient overexpression lysate of homer homolog 2 (Drosophila) (HOMER2), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY404625 Transient overexpression lysate of homer homolog 2 (Drosophila) (HOMER2), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY404626 Transient overexpression lysate of homer homolog 2 (Drosophila) (HOMER2), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY404627 Transient overexpression lysate of homer homolog 2 (Drosophila) (HOMER2), transcript variant 4 (as WB positive control) 100 ug
$436.00
TP304165 Recombinant protein of human homer homolog 2 (Drosophila) (HOMER2), transcript variant 1, 20 µg 20 ug
$737.00
TP318155 Purified recombinant protein of Homo sapiens homer homolog 2 (Drosophila) (HOMER2), transcript variant 4, 20 µg 20 ug
$737.00
TP323154 Purified recombinant protein of Homo sapiens homer homolog 2 (Drosophila) (HOMER2), transcript variant 2, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products