HOMER2 (NM_199331) Human Mass Spec Standard

SKU
PH314311
HOMER2 MS Standard C13 and N15-labeled recombinant protein (NP_955363)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC214311]
Predicted MW 32.7 kDa
Protein Sequence
Protein Sequence
>RC214311 representing NM_199331
Red=Cloning site Green=Tags(s)

MGEQPIFTTRAHVFQIDPNTKKNWMPASKQAVTVSYFYDVTRNSYRIISVDGAKVIINSTITPNMTFTKT
SQKFGQWADSRANTVFGLGFSSEQQLTKFAEKFQEVKEAAKIAKDKTQEKIETSSNHSQASSVNGTDDEK
ASHAGPANTHLKSENDKLKIALTQSAANVKNEINREKEKNTQLKRRIEELEAELREKETELKDLRKQSEI
IPQLMSECEYVSEKLEAAERDNQNLEDKVRSLKTDIEESKYRQRHLKVELKSFLEVLDGKIDDLHDFRRG
LSKLGTDN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_955363
RefSeq Size 1807
RefSeq ORF 864
Synonyms ACPD; CPD; HOMER-2; HOMER2A; HOMER2B; Vesl-2
Locus ID 9455
UniProt ID Q9NSB8
Cytogenetics 15q25.2
Summary This gene encodes a member of the homer family of dendritic proteins. Members of this family regulate group 1 metabotrophic glutamate receptor function. The encoded protein is a postsynaptic density scaffolding protein. Alternative splicing results in multiple transcript variants. Two related pseudogenes have been identified on chromosome 14. [provided by RefSeq, Jun 2011]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:HOMER2 (NM_199331) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH304165 HOMER2 MS Standard C13 and N15-labeled recombinant protein (NP_004830) 10 ug
$3,255.00
PH318155 HOMER2 MS Standard C13 and N15-labeled recombinant protein (NP_955364) 10 ug
$3,255.00
PH323154 HOMER2 MS Standard C13 and N15-labeled recombinant protein (NP_955362) 10 ug
$3,255.00
LC401516 HOMER2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC404625 HOMER2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC404626 HOMER2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC404627 HOMER2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401516 Transient overexpression lysate of homer homolog 2 (Drosophila) (HOMER2), transcript variant 1 100 ug
$436.00
LY404625 Transient overexpression lysate of homer homolog 2 (Drosophila) (HOMER2), transcript variant 2 100 ug
$436.00
LY404626 Transient overexpression lysate of homer homolog 2 (Drosophila) (HOMER2), transcript variant 3 100 ug
$436.00
LY404627 Transient overexpression lysate of homer homolog 2 (Drosophila) (HOMER2), transcript variant 4 100 ug
$436.00
TP304165 Recombinant protein of human homer homolog 2 (Drosophila) (HOMER2), transcript variant 1, 20 µg 20 ug
$737.00
TP314311 Purified recombinant protein of Homo sapiens homer homolog 2 (Drosophila) (HOMER2), transcript variant 3, 20 µg 20 ug
$737.00
TP318155 Purified recombinant protein of Homo sapiens homer homolog 2 (Drosophila) (HOMER2), transcript variant 4, 20 µg 20 ug
$737.00
TP323154 Purified recombinant protein of Homo sapiens homer homolog 2 (Drosophila) (HOMER2), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.