HOMER2 (NM_199332) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC218155] |
Predicted MW | 33.9 kDa |
Protein Sequence |
Protein Sequence
>RC218155 representing NM_199332
Red=Cloning site Green=Tags(s) MGEQPIFTTRAHVFQIDPNTKKNWMPASKQAVTVSYFYDVTRNSYRIISVDGAKVIINSTITPNMTFTKT SQKFGQWADSRANTVFGLGFSSEQQLTKFAEKFQEVKEAAKIAKDKTQEKIETSSNHSQESGRETPSSTQ ASSVNGTDDEKASHAGPANTHLKSENDKLKIALTQSAANVKNEINREKEKNTQLKRRIEELEAELREKET ELKDLRKQSEIIPQLMSECEYVSEKLEAAERDNQNLEDKVRSLKTDIEESKYRQRHLKVELKSFLEVLDG KIDDLHDFRRGLSKLGTDN myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_955364 |
RefSeq Size | 1840 |
RefSeq ORF | 897 |
Synonyms | ACPD; CPD; HOMER-2; HOMER2A; HOMER2B; Vesl-2 |
Locus ID | 9455 |
UniProt ID | Q9NSB8 |
Cytogenetics | 15q25.2 |
Summary | This gene encodes a member of the homer family of dendritic proteins. Members of this family regulate group 1 metabotrophic glutamate receptor function. The encoded protein is a postsynaptic density scaffolding protein. Alternative splicing results in multiple transcript variants. Two related pseudogenes have been identified on chromosome 14. [provided by RefSeq, Jun 2011] |
Protein Families | Druggable Genome |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH304165 | HOMER2 MS Standard C13 and N15-labeled recombinant protein (NP_004830) | 10 ug |
$3,255.00
|
|
PH314311 | HOMER2 MS Standard C13 and N15-labeled recombinant protein (NP_955363) | 10 ug |
$3,255.00
|
|
PH323154 | HOMER2 MS Standard C13 and N15-labeled recombinant protein (NP_955362) | 10 ug |
$3,255.00
|
|
LC401516 | HOMER2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC404625 | HOMER2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC404626 | HOMER2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC404627 | HOMER2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY401516 | Transient overexpression lysate of homer homolog 2 (Drosophila) (HOMER2), transcript variant 1 | 100 ug |
$436.00
|
|
LY404625 | Transient overexpression lysate of homer homolog 2 (Drosophila) (HOMER2), transcript variant 2 | 100 ug |
$436.00
|
|
LY404626 | Transient overexpression lysate of homer homolog 2 (Drosophila) (HOMER2), transcript variant 3 | 100 ug |
$436.00
|
|
LY404627 | Transient overexpression lysate of homer homolog 2 (Drosophila) (HOMER2), transcript variant 4 | 100 ug |
$436.00
|
|
TP304165 | Recombinant protein of human homer homolog 2 (Drosophila) (HOMER2), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
TP314311 | Purified recombinant protein of Homo sapiens homer homolog 2 (Drosophila) (HOMER2), transcript variant 3, 20 µg | 20 ug |
$737.00
|
|
TP318155 | Purified recombinant protein of Homo sapiens homer homolog 2 (Drosophila) (HOMER2), transcript variant 4, 20 µg | 20 ug |
$737.00
|
|
TP323154 | Purified recombinant protein of Homo sapiens homer homolog 2 (Drosophila) (HOMER2), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.