HOMER2 (NM_199332) Human Recombinant Protein

SKU
TP318155
Purified recombinant protein of Homo sapiens homer homolog 2 (Drosophila) (HOMER2), transcript variant 4, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC218155 representing NM_199332
Red=Cloning site Green=Tags(s)

MGEQPIFTTRAHVFQIDPNTKKNWMPASKQAVTVSYFYDVTRNSYRIISVDGAKVIINSTITPNMTFTKT
SQKFGQWADSRANTVFGLGFSSEQQLTKFAEKFQEVKEAAKIAKDKTQEKIETSSNHSQESGRETPSSTQ
ASSVNGTDDEKASHAGPANTHLKSENDKLKIALTQSAANVKNEINREKEKNTQLKRRIEELEAELREKET
ELKDLRKQSEIIPQLMSECEYVSEKLEAAERDNQNLEDKVRSLKTDIEESKYRQRHLKVELKSFLEVLDG
KIDDLHDFRRGLSKLGTDN

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 33.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_955364
Locus ID 9455
UniProt ID Q9NSB8
Cytogenetics 15q25.2
RefSeq Size 1840
RefSeq ORF 897
Synonyms ACPD; CPD; HOMER-2; HOMER2A; HOMER2B; Vesl-2
Summary This gene encodes a member of the homer family of dendritic proteins. Members of this family regulate group 1 metabotrophic glutamate receptor function. The encoded protein is a postsynaptic density scaffolding protein. Alternative splicing results in multiple transcript variants. Two related pseudogenes have been identified on chromosome 14. [provided by RefSeq, Jun 2011]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:HOMER2 (NM_199332) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH304165 HOMER2 MS Standard C13 and N15-labeled recombinant protein (NP_004830) 10 ug
$3,255.00
PH314311 HOMER2 MS Standard C13 and N15-labeled recombinant protein (NP_955363) 10 ug
$3,255.00
PH318155 HOMER2 MS Standard C13 and N15-labeled recombinant protein (NP_955364) 10 ug
$3,255.00
PH323154 HOMER2 MS Standard C13 and N15-labeled recombinant protein (NP_955362) 10 ug
$3,255.00
LC401516 HOMER2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC404625 HOMER2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC404626 HOMER2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC404627 HOMER2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401516 Transient overexpression lysate of homer homolog 2 (Drosophila) (HOMER2), transcript variant 1 100 ug
$436.00
LY404625 Transient overexpression lysate of homer homolog 2 (Drosophila) (HOMER2), transcript variant 2 100 ug
$436.00
LY404626 Transient overexpression lysate of homer homolog 2 (Drosophila) (HOMER2), transcript variant 3 100 ug
$436.00
LY404627 Transient overexpression lysate of homer homolog 2 (Drosophila) (HOMER2), transcript variant 4 100 ug
$436.00
TP304165 Recombinant protein of human homer homolog 2 (Drosophila) (HOMER2), transcript variant 1, 20 µg 20 ug
$737.00
TP314311 Purified recombinant protein of Homo sapiens homer homolog 2 (Drosophila) (HOMER2), transcript variant 3, 20 µg 20 ug
$737.00
TP323154 Purified recombinant protein of Homo sapiens homer homolog 2 (Drosophila) (HOMER2), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.