Hemogen (HEMGN) (NM_197978) Human Recombinant Protein

CAT#: TP314122

Recombinant protein of human hemogen (HEMGN), transcript variant 2, 20 µg

Product Images

Coomassie blue staining of purified HEMGN protein (Cat# TP314122). The protein was produced from HEK293T cells transfected with HEMGN cDNA clone (Cat# RC214122) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC214122 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDLGKDQSHLKHHQTPDPHQEENHSPEVIGTWSLRNRELLRKRKAEVHEKETSQWLFGEQKKRKQQRTGK
  GNRRGRKRQQNTELKVEPQPQIEKEMEKALAPIEKKTEPPGSITKVFPSVASPQKVVPEEHFSEICQESN
  IYQENFSEYQEIAVQNHSSETCQHVSEPEDLSPKMYQEISVLQDNSSKICQDMKEPEDNSPNTCQVISVI
  QDHPFKMYQDMAKREDLAPKMCQEAAVPKILPCPTSEDTADLAGCSLQAYPKPDVPKGYILDTDQNPAEP
  EEYNETDQGIAETEGLFPKIQEIAEPKDLSTKTHQESAEPKYLPHKTCNEIIVPKAPSHKTIQETPHSED
  YSIEINQETPGSEKYSPETYQEIPGLEEYSPEIYQETSQLEEYSPEIYQETPGPEDLSTETYKNKDVPKE
  CFPEPHQETGGPQGQDPKAHQEDAKDAYTFPQEMKEKPKEEPGIPAILNESHPENDVYSYVLF
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 55.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_932095
• Locus ID: 55363
• UniProt ID: Q9BXL5, A0A024R162
• Cytogenetics: 9q22.33
• Refseq Size: 2306
• Refseq ORF: 254
• Synonyms: CT155; EDAG; EDAG-1; NDR
• Summary: Regulates the proliferation and differentiation of hematopoietic cells. Overexpression block the TPA-induced megakaryocytic differentiation in the K562 cell model. May also prevent cell apoptosis through the activation of the nuclear factor-kappa B (NF-kB).[UniProtKB/Swiss-Prot Function]