Hemogen (HEMGN) (NM_197978) Human Mass Spec Standard

SKU
PH314122
HEMGN MS Standard C13 and N15-labeled recombinant protein (NP_932095)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC214122]
Predicted MW 55.3 kDa
Protein Sequence
Protein Sequence
>Peptide sequence encoded by RC214122
Blue=ORF Red=Cloning site Green=Tag(s)

MDLGKDQSHLKHHQTPDPHQEENHSPEVIGTWSLRNRELLRKRKAEVHEKETSQWLFGEQKKRKQQRTG
KGNRRGRKRQQNTELKVEPQPQIEKEMEKALAPIEKKTEPPGSITKVFPSVASPQKVVPEEHFSEICQE
SNIYQENFSEYQEIAVQNHSSETCQHVSEPEDLSPKMYQEISVLQDNSSKICQDMKEPEDNSPNTCQVI
SVIQDHPFKMYQDMAKREDLAPKMCQEAAVPKILPCPTSEDTADLAGCSLQAYPKPDVPKGYILDTDQN
PAEPEEYNETDQGIAETEGLFPKIQEIAEPKDLSTKTHQESAEPKYLPHKTCNEIIVPKAPSHKTIQET
PHSEDYSIEINQETPGSEKYSPETYQEIPGLEEYSPEIYQETSQLEEYSPEIYQETPGPEDLSTETYKN
KDVPKECFPEPHQETGGPQGQDPKAHQEDAKDAYTFPQEMKEKPKEEPGIPAILNESHPENDVYSYVLF

myc-FLAG tag

Recombinant protein using RC214122 also available, TP314122
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_932095
RefSeq Size 2306
RefSeq ORF 1449
Synonyms CT155; EDAG; EDAG-1; NDR
Locus ID 55363
UniProt ID Q9BXL5
Cytogenetics 9q22.33
Summary Regulates the proliferation and differentiation of hematopoietic cells. Overexpression block the TPA-induced megakaryocytic differentiation in the K562 cell model. May also prevent cell apoptosis through the activation of the nuclear factor-kappa B (NF-kB).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Hemogen (HEMGN) (NM_197978) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH308367 HEMGN MS Standard C13 and N15-labeled recombinant protein (NP_060907) 10 ug
$3,255.00
LC402697 HEMGN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC405099 HEMGN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402697 Transient overexpression lysate of hemogen (HEMGN), transcript variant 1 100 ug
$436.00
LY405099 Transient overexpression lysate of hemogen (HEMGN), transcript variant 2 100 ug
$665.00
TP308367 Recombinant protein of human hemogen (HEMGN), transcript variant 1, 20 µg 20 ug
$737.00
TP314122 Recombinant protein of human hemogen (HEMGN), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.