Hemogen (HEMGN) (NM_018437) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC208367] |
Predicted MW | 55.3 kDa |
Protein Sequence |
Protein Sequence
>RC208367 protein sequence
Red=Cloning site Green=Tags(s) MDLGKDQSHLKHHQTPDPHQEENHSPEVIGTWSLRNRELLRKRKAEVHEKETSQWLFGEQKKRKQQRTGK GNRRGRKRQQNTELKVEPQPQIEKEMEKALAPIEKKTEPPGSITKVFPSVASPQKVVPEEHFSEICQESN IYQENFSEYQEIAVQNHSSETCQHVSEPEDLSPKMYQEISVLQDNSSKICQDMKEPEDNSPNTCQVISVI QDHPFKMYQDMAKREDLAPKMCQEAAVPKILPCPTSEDTADLAGCSLQAYPKPDVPKGYILDTDQNPAEP EEYNETDQGIAETEGLFPKIQEIAEPKDLSTKTHQESAEPKYLPHKTCNEIIVPKAPSHKTIQETPHSED YSIEINQETPGSEKYSPETYQEIPGLEEYSPEIYQETSQLEEYSPEIYQETPGPEDLSTETYKNKDVPKE CFPEPHQETGGPQGQDPKAHQEDAKDAYTFPQEMKEKPKEEPGIPAILNESHPENDVYSYVLF myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_060907 |
RefSeq Size | 2252 |
RefSeq ORF | 1449 |
Synonyms | CT155; EDAG; EDAG-1; NDR |
Locus ID | 55363 |
UniProt ID | Q9BXL5 |
Cytogenetics | 9q22.33 |
Summary | Regulates the proliferation and differentiation of hematopoietic cells. Overexpression block the TPA-induced megakaryocytic differentiation in the K562 cell model. May also prevent cell apoptosis through the activation of the nuclear factor-kappa B (NF-kB).[UniProtKB/Swiss-Prot Function] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH314122 | HEMGN MS Standard C13 and N15-labeled recombinant protein (NP_932095) | 10 ug |
$3,255.00
|
|
LC402697 | HEMGN HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC405099 | HEMGN HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LY402697 | Transient overexpression lysate of hemogen (HEMGN), transcript variant 1 | 100 ug |
$436.00
|
|
LY405099 | Transient overexpression lysate of hemogen (HEMGN), transcript variant 2 | 100 ug |
$665.00
|
|
TP308367 | Recombinant protein of human hemogen (HEMGN), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
TP314122 | Recombinant protein of human hemogen (HEMGN), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.