Hemogen (HEMGN) (NM_197978) Human Recombinant Protein

SKU
TP314122
Recombinant protein of human hemogen (HEMGN), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>Peptide sequence encoded by RC214122
Blue=ORF Red=Cloning site Green=Tag(s)

MDLGKDQSHLKHHQTPDPHQEENHSPEVIGTWSLRNRELLRKRKAEVHEKETSQWLFGEQKKRKQQRTG
KGNRRGRKRQQNTELKVEPQPQIEKEMEKALAPIEKKTEPPGSITKVFPSVASPQKVVPEEHFSEICQE
SNIYQENFSEYQEIAVQNHSSETCQHVSEPEDLSPKMYQEISVLQDNSSKICQDMKEPEDNSPNTCQVI
SVIQDHPFKMYQDMAKREDLAPKMCQEAAVPKILPCPTSEDTADLAGCSLQAYPKPDVPKGYILDTDQN
PAEPEEYNETDQGIAETEGLFPKIQEIAEPKDLSTKTHQESAEPKYLPHKTCNEIIVPKAPSHKTIQET
PHSEDYSIEINQETPGSEKYSPETYQEIPGLEEYSPEIYQETSQLEEYSPEIYQETPGPEDLSTETYKN
KDVPKECFPEPHQETGGPQGQDPKAHQEDAKDAYTFPQEMKEKPKEEPGIPAILNESHPENDVYSYVLF

myc-FLAG tag

Recombinant protein using RC214122 also available, TP314122
Tag C-Myc/DDK
Predicted MW 55.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_932095
Locus ID 55363
UniProt ID Q9BXL5
Cytogenetics 9q22.33
RefSeq Size 2306
RefSeq ORF 1449
Synonyms CT155; EDAG; EDAG-1; NDR
Summary Regulates the proliferation and differentiation of hematopoietic cells. Overexpression block the TPA-induced megakaryocytic differentiation in the K562 cell model. May also prevent cell apoptosis through the activation of the nuclear factor-kappa B (NF-kB).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Hemogen (HEMGN) (NM_197978) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH308367 HEMGN MS Standard C13 and N15-labeled recombinant protein (NP_060907) 10 ug
$3,255.00
PH314122 HEMGN MS Standard C13 and N15-labeled recombinant protein (NP_932095) 10 ug
$3,255.00
LC402697 HEMGN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC405099 HEMGN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402697 Transient overexpression lysate of hemogen (HEMGN), transcript variant 1 100 ug
$436.00
LY405099 Transient overexpression lysate of hemogen (HEMGN), transcript variant 2 100 ug
$665.00
TP308367 Recombinant protein of human hemogen (HEMGN), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.