OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GAA (NM_001079804) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP308033
Recombinant protein of human glucosidase, alpha; acid (GAA), transcript variant 3, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA334653 Rabbit Polyclonal Anti-GAA Antibody
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "GAA or NM_001079804"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC208033 protein sequence
Red=Cloning site Green=Tags(s)

MGVRHPPCSHRLLAVCALVSLATAALLGHILLHDFLLVPRELSGSSPVLEETHPAHQQGASRPGPRDAQA
HPGRPRAVPTQCDVPPNSRFDCAPDKAITQEQCEARGCCYIPAKQGLQGAQMGQPWCFFPPSYPSYKLEN
LSSSEMGYTATLTRTTPTFFPKDILTLRLDVMMETENRLHFTIKDPANRRYEVPLETPHVHSRAPSPLYS
VEFSEEPFGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPLMLSTSWTRITLWN
RDLAPTPGANLYGSHPFYLALEDGGSAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDVYIFLGPEPKSV
VQQYLDVVGYPFMPPYWGLGFHLCRWGYSSTAITRQVVENMTRAHFPLDVQWNDLDYMDSRRDFTFNKDG
FRDFPAMVQELHQGGRRYMMIVDPAISSSGPAGSYRPYDEGLRRGVFITNETGQPLIGKVWPGSTAFPDF
TNPTALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIRGSEDGCPNNELENPPYVPGVVGGTLQAATICAS
SHQFLSTHYNLHNLYGLTEAIASHRALVKARGTRPFVISRSTFAGHGRYAGHWTGDVWSSWEQLASSVPE
ILQFNLLGVPLVGADVCGFLGNTSEELCVRWTQLGAFYPFMRNHNSLLSLPQEPYSFSEPAQQAMRKALT
LRYALLPHLYTLFHQAHVAGETVARPLFLEFPKDSSTWTVDHQLLWGEALLITPVLQAGKAEVTGYFPLG
TWYDLQTVPVEALGSLPPPPAAPREPAIHSEGQWVTLPAPLDTINVHLRAGYIIPLQGPGLTTTESRQQP
MALAVALTKGGEARGELFWDDGESLEVLERGAYTQVIFLARNNTIVNELVRVTSEGAGLQLQKVTVLGVA
TAPQQVLSNGVPVSNFTYSPDTKVLDICVSLLMGEQFLVSWC

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 102.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001073272
Locus ID 2548
UniProt ID P10253
Cytogenetics 17q25.3
RefSeq Size 3517
RefSeq ORF 2856
Synonyms LYAG
Summary This gene encodes lysosomal alpha-glucosidase, which is essential for the degradation of glycogen to glucose in lysosomes. The encoded preproprotein is proteolytically processed to generate multiple intermediate forms and the mature form of the enzyme. Defects in this gene are the cause of glycogen storage disease II, also known as Pompe's disease, which is an autosomal recessive disorder with a broad clinical spectrum. Alternative splicing results in multiple transcript variants. provided by RefSeq, Jan 2016
Protein Categories Membrane Proteins
Protein Families Druggable Genome, Transmembrane
Protein Pathways Galactose metabolism, Lysosome, Metabolic pathways, Starch and sucrose metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GAA" proteins (12)
SKU Description Size Price
PH308033 GAA MS Standard C13 and N15-labeled recombinant protein (NP_001073272) 10 ug
$3,360.00
PH315796 GAA MS Standard C13 and N15-labeled recombinant protein (NP_000143) 10 ug
$3,360.00
PH315840 GAA MS Standard C13 and N15-labeled recombinant protein (NP_001073271) 10 ug
$3,360.00
LC400052 Lyophilized GAA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421540 Lyophilized GAA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421541 Lyophilized GAA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400052 Transient overexpression lysate of glucosidase, alpha; acid (GAA), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY421540 Transient overexpression lysate of glucosidase, alpha; acid (GAA), transcript variant 2 (as WB positive control) 100 ug
$665.00
LY421541 Transient overexpression lysate of glucosidase, alpha; acid (GAA), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP315796 Recombinant protein of human glucosidase, alpha; acid (GAA), transcript variant 1, 20 µg 20 ug
$737.00
TP315840 Recombinant protein of human glucosidase, alpha; acid (GAA), transcript variant 2, 20 µg 20 ug
$737.00
TP701073 Purified recombinant protein of Human glucosidase, alpha, acid (GAA), with N-terminal His tag, secretory expressed in HEK293 cells, 20ug 20 ug
$900.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products