GAA (NM_001079803) Human Recombinant Protein

SKU
TP315840
Recombinant protein of human glucosidase, alpha; acid (GAA), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC215840 protein sequence
Red=Cloning site Green=Tags(s)

MGVRHPPCSHRLLAVCALVSLATAALLGHILLHDFLLVPRELSGSSPVLEETHPAHQQGASRPGPRDAQA
HPGRPRAVPTQCDVPPNSRFDCAPDKAITQEQCEARGCCYIPAKQGLQGAQMGQPWCFFPPSYPSYKLEN
LSSSEMGYTATLTRTTPTFFPKDILTLRLDVMMETENRLHFTIKDPANRRYEVPLETPHVHSRAPSPLYS
VEFSEEPFGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPLMLSTSWTRITLWN
RDLAPTPGANLYGSHPFYLALEDGGSAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDVYIFLGPEPKSV
VQQYLDVVGYPFMPPYWGLGFHLCRWGYSSTAITRQVVENMTRAHFPLDVQWNDLDYMDSRRDFTFNKDG
FRDFPAMVQELHQGGRRYMMIVDPAISSSGPAGSYRPYDEGLRRGVFITNETGQPLIGKVWPGSTAFPDF
TNPTALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIRGSEDGCPNNELENPPYVPGVVGGTLQAATICAS
SHQFLSTHYNLHNLYGLTEAIASHRALVKARGTRPFVISRSTFAGHGRYAGHWTGDVWSSWEQLASSVPE
ILQFNLLGVPLVGADVCGFLGNTSEELCVRWTQLGAFYPFMRNHNSLLSLPQEPYSFSEPAQQAMRKALT
LRYALLPHLYTLFHQAHVAGETVARPLFLEFPKDSSTWTVDHQLLWGEALLITPVLQAGKAEVTGYFPLG
TWYDLQTVPVEALGSLPPPPAAPREPAIHSEGQWVTLPAPLDTINVHLRAGYIIPLQGPGLTTTESRQQP
MALAVALTKGGEARGELFWDDGESLEVLERGAYTQVIFLARNNTIVNELVRVTSEGAGLQLQKVTVLGVA
TAPQQVLSNGVPVSNFTYSPDTKVLDICVSLLMGEQFLVSWC

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 102.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001073271
Locus ID 2548
UniProt ID P10253
Cytogenetics 17q25.3
RefSeq Size 3597
RefSeq ORF 2856
Synonyms LYAG
Summary This gene encodes lysosomal alpha-glucosidase, which is essential for the degradation of glycogen to glucose in lysosomes. The encoded preproprotein is proteolytically processed to generate multiple intermediate forms and the mature form of the enzyme. Defects in this gene are the cause of glycogen storage disease II, also known as Pompe's disease, which is an autosomal recessive disorder with a broad clinical spectrum. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]
Protein Families Druggable Genome, Transmembrane
Protein Pathways Galactose metabolism, Lysosome, Metabolic pathways, Starch and sucrose metabolism
Write Your Own Review
You're reviewing:GAA (NM_001079803) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH308033 GAA MS Standard C13 and N15-labeled recombinant protein (NP_001073272) 10 ug
$3,255.00
PH315796 GAA MS Standard C13 and N15-labeled recombinant protein (NP_000143) 10 ug
$3,255.00
PH315840 GAA MS Standard C13 and N15-labeled recombinant protein (NP_001073271) 10 ug
$3,255.00
LC400052 GAA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421540 GAA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421541 GAA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400052 Transient overexpression lysate of glucosidase, alpha; acid (GAA), transcript variant 1 100 ug
$436.00
LY421540 Transient overexpression lysate of glucosidase, alpha; acid (GAA), transcript variant 2 100 ug
$665.00
LY421541 Transient overexpression lysate of glucosidase, alpha; acid (GAA), transcript variant 3 100 ug
$436.00
TP308033 Recombinant protein of human glucosidase, alpha; acid (GAA), transcript variant 3, 20 µg 20 ug
$737.00
TP315796 Recombinant protein of human glucosidase, alpha; acid (GAA), transcript variant 1, 20 µg 20 ug
$737.00
TP701073 Purified recombinant protein of Human glucosidase, alpha, acid (GAA), with N-terminal His tag, secretory expressed in HEK293 cells, 20ug 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.