GAA (NM_000152) Human Mass Spec Standard

SKU
PH315796
GAA MS Standard C13 and N15-labeled recombinant protein (NP_000143)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC215796]
Predicted MW 105.32 kDa
Protein Sequence
Protein Sequence
>RC215796 representing NM_000152
Red=Cloning site Green=Tags(s)

MGVRHPPCSHRLLAVCALVSLATAALLGHILLHDFLLVPRELSGSSPVLEETHPAHQQGASRPGPRDAQA
HPGRPRAVPTQCDVPPNSRFDCAPDKAITQEQCEARGCCYIPAKQGLQGAQMGQPWCFFPPSYPSYKLEN
LSSSEMGYTATLTRTTPTFFPKDILTLRLDVMMETENRLHFTIKDPANRRYEVPLETPHVHSRAPSPLYS
VEFSEEPFGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPLMLSTSWTRITLWN
RDLAPTPGANLYGSHPFYLALEDGGSAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDVYIFLGPEPKSV
VQQYLDVVGYPFMPPYWGLGFHLCRWGYSSTAITRQVVENMTRAHFPLDVQWNDLDYMDSRRDFTFNKDG
FRDFPAMVQELHQGGRRYMMIVDPAISSSGPAGSYRPYDEGLRRGVFITNETGQPLIGKVWPGSTAFPDF
TNPTALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIRGSEDGCPNNELENPPYVPGVVGGTLQAATICAS
SHQFLSTHYNLHNLYGLTEAIASHRALVKARGTRPFVISRSTFAGHGRYAGHWTGDVWSSWEQLASSVPE
ILQFNLLGVPLVGADVCGFLGNTSEELCVRWTQLGAFYPFMRNHNSLLSLPQEPYSFSEPAQQAMRKALT
LRYALLPHLYTLFHQAHVAGETVARPLFLEFPKDSSTWTVDHQLLWGEALLITPVLQAGKAEVTGYFPLG
TWYDLQTVPVEALGSLPPPPAAPREPAIHSEGQWVTLPAPLDTINVHLRAGYIIPLQGPGLTTTESRQQP
MALAVALTKGGEARGELFWDDGESLEVLERGAYTQVIFLARNNTIVNELVRVTSEGAGLQLQKVTVLGVA
TAPQQVLSNGVPVSNFTYSPDTKVLDICVSLLMGEQFLVSWC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000143
RefSeq Size 3846
RefSeq ORF 2856
Synonyms LYAG
Locus ID 2548
UniProt ID P10253
Cytogenetics 17q25.3
Summary This gene encodes lysosomal alpha-glucosidase, which is essential for the degradation of glycogen to glucose in lysosomes. The encoded preproprotein is proteolytically processed to generate multiple intermediate forms and the mature form of the enzyme. Defects in this gene are the cause of glycogen storage disease II, also known as Pompe's disease, which is an autosomal recessive disorder with a broad clinical spectrum. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]
Protein Families Druggable Genome, Transmembrane
Protein Pathways Galactose metabolism, Lysosome, Metabolic pathways, Starch and sucrose metabolism
Write Your Own Review
You're reviewing:GAA (NM_000152) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH308033 GAA MS Standard C13 and N15-labeled recombinant protein (NP_001073272) 10 ug
$3,255.00
PH315840 GAA MS Standard C13 and N15-labeled recombinant protein (NP_001073271) 10 ug
$3,255.00
LC400052 GAA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421540 GAA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421541 GAA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400052 Transient overexpression lysate of glucosidase, alpha; acid (GAA), transcript variant 1 100 ug
$436.00
LY421540 Transient overexpression lysate of glucosidase, alpha; acid (GAA), transcript variant 2 100 ug
$665.00
LY421541 Transient overexpression lysate of glucosidase, alpha; acid (GAA), transcript variant 3 100 ug
$436.00
TP308033 Recombinant protein of human glucosidase, alpha; acid (GAA), transcript variant 3, 20 µg 20 ug
$737.00
TP315796 Recombinant protein of human glucosidase, alpha; acid (GAA), transcript variant 1, 20 µg 20 ug
$737.00
TP315840 Recombinant protein of human glucosidase, alpha; acid (GAA), transcript variant 2, 20 µg 20 ug
$737.00
TP701073 Purified recombinant protein of Human glucosidase, alpha, acid (GAA), with N-terminal His tag, secretory expressed in HEK293 cells, 20ug 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.