OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CD33 (NM_001772) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP307023
Recombinant protein of human CD33 molecule (CD33), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA506294 CD33 mouse monoclonal antibody, clone OTI2C1 (formerly 2C1) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "CD33 or NM_001772"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC207023 protein sequence
Red=Cloning site Green=Tags(s)

MPLLLLLPLLWAGALAMDPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISGD
SPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTD
LTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNL
TCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVHGAIGGAGVTALLALCLCLIFF
IVKTHRRKAARTAVGRNDTHPTTGSASPKHQKKSKLHGPTETSSCSGAAPTVEMDEELHYASLNFHGMNP
SKDTSTEYSEVRTQ

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 38 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity Association in cell culture (PMID: 27757305)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001763
Locus ID 945
UniProt ID P20138
Cytogenetics 19q13.41
RefSeq Size 1466
RefSeq ORF 1092
Synonyms p67; SIGLEC-3; SIGLEC3
Summary Sialic-acid-binding immunoglobulin-like lectin (Siglec) that plays a role in mediating cell-cell interactions and in maintaining immune cells in a resting state (PubMed:10611343, PubMed:15597323, PubMed:11320212). Preferentially recognizes and binds alpha-2,3- and more avidly alpha-2,6-linked sialic acid-bearing glycans (PubMed:7718872). Upon engagement of ligands such as C1q or syalylated glycoproteins, two immunoreceptor tyrosine-based inhibitory motifs (ITIMs) located in CD33 cytoplasmic tail are phosphorylated by Src-like kinases such as LCK (PubMed:28325905, PubMed:10887109). These phosphorylations provide docking sites for the recruitment and activation of protein-tyrosine phosphatases PTPN6/SHP-1 and PTPN11/SHP-2 (PubMed:10556798, PubMed:10206955, PubMed:10887109). In turn, these phosphatases regulate downstream pathways through dephosphorylation of signaling molecules (PubMed:10206955, PubMed:10887109). One of the repressive effect of CD33 on monocyte activation requires phosphoinositide 3-kinase/PI3K (PubMed:15597323).UniProtKB/Swiss-Prot Function
Protein Categories ADC Targets, CAR-T Targets, CD Markers, Cytokines, Membrane Proteins
Protein Families Druggable Genome, Transmembrane
Protein Pathways Hematopoietic cell lineage
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CD33" proteins (13)
SKU Description Size Price
PH307023 CD33 MS Standard C13 and N15-labeled recombinant protein (NP_001763) 10 ug
$3,360.00
PH317716 CD33 MS Standard C13 and N15-labeled recombinant protein (NP_001076087) 10 ug
$3,360.00
LC400667 Lyophilized CD33 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421195 Lyophilized CD33 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC425947 Lyophilized CD33 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC432863 Lyophilized CD33 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400667 Transient overexpression lysate of CD33 molecule (CD33), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY421195 Transient overexpression lysate of CD33 molecule (CD33), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY425947 Transient overexpression lysate of CD33 molecule (CD33), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY432863 Transient overexpression lysate of CD33 molecule (CD33), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP317716 Purified recombinant protein of Homo sapiens CD33 molecule (CD33), transcript variant 2, 20 µg 20 ug
$737.00
TP720665 Purified recombinant protein of Human CD33 molecule (CD33), transcript variant 1 10 ug
$235.00
TP723960 Recombinant human CD33 protein with C-terminal human Fc and 6×His tag 100 ug
$770.00

file-alt Citations

Mono- and dual-targeting triplebodies activate natural killer cells and have anti-tumor activity in vitro and in vivo against chronic lymphocytic leukemia
Vyas, Schneider, Shatnyeva et al
Oncoimmunology (2016) 5 (9), e1211220 DOI: 10.1080/2162402X.2016.1211220
AI Summary: OriGene’s recombinant human CD33-FLAG protein (Cat. TP307023) was used in this study to detect the binding of dual-targeting triplebodies to CD33 on target cells, facilitating the evaluation of triplebody specificity and function.
Snippet: For detection of simultaneous binding of a dual-targeting triplebody ULBP2-aCD19-aCD33, immunoligands were incubated with CD19+ MEC1 cells and bound immunoligands were detected using recombinant human NKG2D-Fc receptor and recombinant human CD33-FLAG (Origene, Cat. TP307023)
Mono-and dual-targeting triplebodies activate natural killer cells and have anti-tumor activity in vitro and in vivo against chronic lymphocytic leukemia
Vyas, Schneider, Shatnyeva et al
OncoImmunology (2016)
AI Summary: OriGene’s recombinant human CD33-FLAG protein (Cat. TP307023) was used in this study to detect the binding of dual-targeting triplebodies to CD19+ MEC1 cells, enabling assessment of their interaction with target antigens.
Snippet: … For detection of simultaneous binding of a dual targeting triplebody ULBP2- aCD19-aCD33, immunoligands were incubated with CD19+ MEC1 cells and bound immunoligands were detected using recombinant human NKG2D-Fc receptor and recombinant human CD33-FLAG (Origene, Cat. TP307023). Bound CD33-FLAG receptor was in turn detected using FLAG/DDK tag specific PE labeled antibody (clone poly9236, BioLegend). …
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products