CD33 (NM_001772) Human Recombinant Protein

  • Product Brand Image
SKU
TP307023
Recombinant protein of human CD33 molecule (CD33), transcript variant 1, 20 µg
In Control Promo
  $737.00
In Stock*
Bulk/Customize
Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC207023 protein sequence
Red=Cloning site Green=Tags(s)

MPLLLLLPLLWAGALAMDPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISGD
SPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTD
LTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNL
TCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVHGAIGGAGVTALLALCLCLIFF
IVKTHRRKAARTAVGRNDTHPTTGSASPKHQKKSKLHGPTETSSCSGAAPTVEMDEELHYASLNFHGMNP
SKDTSTEYSEVRTQ

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 38 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity Association in cell culture (PMID: 27757305)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001763
Locus ID 945
UniProt ID P20138
Cytogenetics 19q13.41
RefSeq Size 1466
RefSeq ORF 1092
Synonyms p67; SIGLEC-3; SIGLEC3
Summary Sialic-acid-binding immunoglobulin-like lectin (Siglec) that plays a role in mediating cell-cell interactions and in maintaining immune cells in a resting state (PubMed:10611343, PubMed:15597323, PubMed:11320212). Preferentially recognizes and binds alpha-2,3- and more avidly alpha-2,6-linked sialic acid-bearing glycans (PubMed:7718872). Upon engagement of ligands such as C1q or syalylated glycoproteins, two immunoreceptor tyrosine-based inhibitory motifs (ITIMs) located in CD33 cytoplasmic tail are phosphorylated by Src-like kinases such as LCK (PubMed:28325905, PubMed:10887109). These phosphorylations provide docking sites for the recruitment and activation of protein-tyrosine phosphatases PTPN6/SHP-1 and PTPN11/SHP-2 (PubMed:10556798, PubMed:10206955, PubMed:10887109). In turn, these phosphatases regulate downstream pathways through dephosphorylation of signaling molecules (PubMed:10206955, PubMed:10887109). One of the repressive effect of CD33 on monocyte activation requires phosphoinositide 3-kinase/PI3K (PubMed:15597323).UniProtKB/Swiss-Prot Function
Protein Categories ADC Targets, CAR-T Targets, CD Markers, Cytokines, Membrane Proteins
Protein Families Druggable Genome, Transmembrane
Protein Pathways Hematopoietic cell lineage
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
Other "CD33" proteins (13)
SKU Description Size Price
PH307023 CD33 MS Standard C13 and N15-labeled recombinant protein (NP_001763) 10 ug
$3,360.00
PH317716 CD33 MS Standard C13 and N15-labeled recombinant protein (NP_001076087) 10 ug
$3,360.00
LC400667 CD33 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421195 CD33 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC425947 CD33 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC432863 CD33 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400667 Transient overexpression lysate of CD33 molecule (CD33), transcript variant 1 100 ug
$436.00
LY421195 Transient overexpression lysate of CD33 molecule (CD33), transcript variant 2 100 ug
$436.00
LY425947 Transient overexpression lysate of CD33 molecule (CD33), transcript variant 2 100 ug
$436.00
LY432863 Transient overexpression lysate of CD33 molecule (CD33), transcript variant 3 100 ug
$436.00
TP317716 Purified recombinant protein of Homo sapiens CD33 molecule (CD33), transcript variant 2, 20 µg 20 ug
$737.00
TP720665 Purified recombinant protein of Human CD33 molecule (CD33), transcript variant 1 10 ug
$235.00
TP723960 Human CD33 Protein, hFc-His Tag 100 ug
$805.00
OriGene AI

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.