OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CD33 (NM_001082618) Human Mass Spec Standard

Be the first to review this product
SKU
PH317716
CD33 MS Standard C13 and N15-labeled recombinant protein (NP_001076087)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA506294 CD33 mouse monoclonal antibody, clone OTI2C1 (formerly 2C1) 100 ul
$447.00
LY400667 Transient overexpression lysate of CD33 molecule (CD33), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "CD33 or NM_001082618"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC217716
Predicted MW 25.29 kDa
Protein Sequence
Protein Sequence
>RC217716 representing NM_001082618
Red=Cloning site Green=Tags(s)

MPLLLLLPLLWADLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVL
IITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVHGAIGGAGV
TALLALCLCLIFFIVKTHRRKAARTAVGRNDTHPTTGSASPKHQKKSKLHGPTETSSCSGAAPTVEMDEE
LHYASLNFHGMNPSKDTSTEYSEVRTQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001076087
RefSeq Size 1085
RefSeq ORF 711
Synonyms p67; SIGLEC-3; SIGLEC3
Locus ID 945
UniProt ID P20138
Cytogenetics 19q13.41
Summary Sialic-acid-binding immunoglobulin-like lectin (Siglec) that plays a role in mediating cell-cell interactions and in maintaining immune cells in a resting state (PubMed:10611343, PubMed:15597323, PubMed:11320212). Preferentially recognizes and binds alpha-2,3- and more avidly alpha-2,6-linked sialic acid-bearing glycans (PubMed:7718872). Upon engagement of ligands such as C1q or syalylated glycoproteins, two immunoreceptor tyrosine-based inhibitory motifs (ITIMs) located in CD33 cytoplasmic tail are phosphorylated by Src-like kinases such as LCK (PubMed:28325905, PubMed:10887109). These phosphorylations provide docking sites for the recruitment and activation of protein-tyrosine phosphatases PTPN6/SHP-1 and PTPN11/SHP-2 (PubMed:10556798, PubMed:10206955, PubMed:10887109). In turn, these phosphatases regulate downstream pathways through dephosphorylation of signaling molecules (PubMed:10206955, PubMed:10887109). One of the repressive effect of CD33 on monocyte activation requires phosphoinositide 3-kinase/PI3K (PubMed:15597323).UniProtKB/Swiss-Prot Function
Protein Families Druggable Genome, Transmembrane
Protein Pathways Hematopoietic cell lineage
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "CD33" proteins (13)
SKU Description Size Price
PH307023 CD33 MS Standard C13 and N15-labeled recombinant protein (NP_001763) 10 ug
$3,360.00
LC400667 Lyophilized CD33 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421195 Lyophilized CD33 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC425947 Lyophilized CD33 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC432863 Lyophilized CD33 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400667 Transient overexpression lysate of CD33 molecule (CD33), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY421195 Transient overexpression lysate of CD33 molecule (CD33), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY425947 Transient overexpression lysate of CD33 molecule (CD33), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY432863 Transient overexpression lysate of CD33 molecule (CD33), transcript variant 3 (as WB positive control) 100 ug
$436.00
TP307023 Recombinant protein of human CD33 molecule (CD33), transcript variant 1, 20 µg 20 ug
$737.00
TP317716 Purified recombinant protein of Homo sapiens CD33 molecule (CD33), transcript variant 2, 20 µg 20 ug
$737.00
TP720665 Purified recombinant protein of Human CD33 molecule (CD33), transcript variant 1 10 ug
$235.00
TP723960 Recombinant human CD33 protein with C-terminal human Fc and 6×His tag 100 ug
$770.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products