CD33 (NM_001772) Human Mass Spec Standard
$3,255.00
2 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC207023] |
Predicted MW | 39.7 kDa |
Protein Sequence |
Protein Sequence
>RC207023 protein sequence
Red=Cloning site Green=Tags(s) MPLLLLLPLLWAGALAMDPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISGD SPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTD LTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNL TCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVHGAIGGAGVTALLALCLCLIFF IVKTHRRKAARTAVGRNDTHPTTGSASPKHQKKSKLHGPTETSSCSGAAPTVEMDEELHYASLNFHGMNP SKDTSTEYSEVRTQ myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001763 |
RefSeq Size | 1466 |
RefSeq ORF | 1092 |
Synonyms | p67; SIGLEC-3; SIGLEC3 |
Locus ID | 945 |
UniProt ID | P20138 |
Cytogenetics | 19q13.41 |
Summary | Sialic-acid-binding immunoglobulin-like lectin (Siglec) that plays a role in mediating cell-cell interactions and in maintaining immune cells in a resting state (PubMed:10611343, PubMed:15597323, PubMed:11320212). Preferentially recognizes and binds alpha-2,3- and more avidly alpha-2,6-linked sialic acid-bearing glycans (PubMed:7718872). Upon engagement of ligands such as C1q or syalylated glycoproteins, two immunoreceptor tyrosine-based inhibitory motifs (ITIMs) located in CD33 cytoplasmic tail are phosphorylated by Src-like kinases such as LCK (PubMed:28325905, PubMed:10887109). These phosphorylations provide docking sites for the recruitment and activation of protein-tyrosine phosphatases PTPN6/SHP-1 and PTPN11/SHP-2 (PubMed:10556798, PubMed:10206955, PubMed:10887109). In turn, these phosphatases regulate downstream pathways through dephosphorylation of signaling molecules (PubMed:10206955, PubMed:10887109). One of the repressive effect of CD33 on monocyte activation requires phosphoinositide 3-kinase/PI3K (PubMed:15597323).[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Hematopoietic cell lineage |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH317716 | CD33 MS Standard C13 and N15-labeled recombinant protein (NP_001076087) | 10 ug |
$3,255.00
|
|
LC400667 | CD33 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC421195 | CD33 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC425947 | CD33 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC432863 | CD33 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY400667 | Transient overexpression lysate of CD33 molecule (CD33), transcript variant 1 | 100 ug |
$436.00
|
|
LY421195 | Transient overexpression lysate of CD33 molecule (CD33), transcript variant 2 | 100 ug |
$436.00
|
|
LY425947 | Transient overexpression lysate of CD33 molecule (CD33), transcript variant 2 | 100 ug |
$436.00
|
|
LY432863 | Transient overexpression lysate of CD33 molecule (CD33), transcript variant 3 | 100 ug |
$436.00
|
|
TP307023 | Recombinant protein of human CD33 molecule (CD33), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
TP317716 | Purified recombinant protein of Homo sapiens CD33 molecule (CD33), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
TP720665 | Purified recombinant protein of Human CD33 molecule (CD33), transcript variant 1 | 10 ug |
$230.00
|
|
TP723960 | Human CD33 Protein, hFc-His Tag | 100 ug |
$595.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.