TMEM231 (NM_001077419) Human Recombinant Protein

CAT#: TP303675

Recombinant protein of human hypothetical protein FLJ22167 (FLJ22167), transcript variant 3, 20 µg

Product Images

Coomassie blue staining of purified TMEM231 protein (Cat# TP303675). The protein was produced from HEK293T cells transfected with TMEM231 cDNA clone (Cat# [RC203675]) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203675 representing NM_001077419
  Red=Cloning site Green=Tags(s)
  
  MALYELFSHPVERSYRAGLCSKAALFLLLAAALTYIPPLLVAFRSHGFWLKRSSYEEQPTVRFQHQVLLV
  ALLGPESDGFLAWSTFPAFNRLQGDRLRVPLVSTREEDRNQDGKTDMLHFKLELPLQSTEHVLGVQLILT
  FSYRLHRMATLVMQSMAFLQSSFPVPGSQLYVNGDLRLQQKQPLSCGGLDARYNISVINGTSPFAYDYDL
  THIVAAYQERNVTTVLNDPNPIWLVGRAADAPFVINAIIRYPVEVISYQPGFWEMVKFAWVQYVSILLIF
  LWVFERIKIFVFQNQVVTTIPVTVTPRGDLCKEHLS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 22.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001070887
• Locus ID: 79583
• UniProt ID: Q9H6L2
• Cytogenetics: 16q23.1
• Refseq Size: 3034
• Refseq ORF: 603
• Synonyms: ALYE870; JBTS20; PRO1886
• Summary: This gene encodes a transmembrane protein, which is a component of the B9 complex involved in the formation of the diffusion barrier between the cilia and plasma membrane. Mutations in this gene cause Joubert syndrome (JBTS). Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jan 2013]
• Protein Families: Transmembrane