TMEM231 (NM_001077418) Human Recombinant Protein

SKU
TP312590
Recombinant protein of human hypothetical protein FLJ22167 (FLJ22167), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC212590 representing NM_001077418
Red=Cloning site Green=Tags(s)

MALYELFSHPVERSYRAGLCSKAALFLLLAAALTYIPPLLVAFRSHGFWLKRSSYEEQPTVRFQHQVLLV
ALLGPESDGFLAWSTFPAFNRLQGDRLRVPLVSTREEDRNQDGKTDMLHFKLELPLQSTEHVLGVQLILT
FSYRLHRMATLVMQSMAFLQSSFPVPGSQLYVNGDLRLQQKQPLSCGGLDARYNISVINGTSPFAYDYDL
THIVAAYQERNVTTVLNDPNPIWLVGRAADAPFVINAIIRYPVEVISYQPGFWEMVKFAWVQYVSILLIF
LWVFERIKIFVFQNQVVTTIPVTVTPRGDLCKEHLS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 35.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001070886
Locus ID 79583
UniProt ID Q9H6L2
Cytogenetics 16q23.1
RefSeq Size 2911
RefSeq ORF 948
Synonyms ALYE870; JBTS20; MKS11; PRO1886
Summary This gene encodes a transmembrane protein, which is a component of the B9 complex involved in the formation of the diffusion barrier between the cilia and plasma membrane. Mutations in this gene cause Joubert syndrome (JBTS). Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jan 2013]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:TMEM231 (NM_001077418) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH312590 TMEM231 MS Standard C13 and N15-labeled recombinant protein (NP_001070886) 10 ug
$3,255.00
LC421412 TMEM231 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421413 TMEM231 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY421412 Transient overexpression lysate of transmembrane protein 231 (TMEM231), transcript variant 1 100 ug
$436.00
LY421413 Transient overexpression lysate of transmembrane protein 231 (TMEM231), transcript variant 2 100 ug
$436.00
TP303675 Recombinant protein of human hypothetical protein FLJ22167 (FLJ22167), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.