TMEM231 (NM_001077418) Human Mass Spec Standard

SKU
PH312590
TMEM231 MS Standard C13 and N15-labeled recombinant protein (NP_001070886)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC212590]
Predicted MW 35.9 kDa
Protein Sequence
Protein Sequence
>RC212590 representing NM_001077418
Red=Cloning site Green=Tags(s)

MALYELFSHPVERSYRAGLCSKAALFLLLAAALTYIPPLLVAFRSHGFWLKRSSYEEQPTVRFQHQVLLV
ALLGPESDGFLAWSTFPAFNRLQGDRLRVPLVSTREEDRNQDGKTDMLHFKLELPLQSTEHVLGVQLILT
FSYRLHRMATLVMQSMAFLQSSFPVPGSQLYVNGDLRLQQKQPLSCGGLDARYNISVINGTSPFAYDYDL
THIVAAYQERNVTTVLNDPNPIWLVGRAADAPFVINAIIRYPVEVISYQPGFWEMVKFAWVQYVSILLIF
LWVFERIKIFVFQNQVVTTIPVTVTPRGDLCKEHLS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001070886
RefSeq Size 2911
RefSeq ORF 948
Synonyms ALYE870; JBTS20; MKS11; PRO1886
Locus ID 79583
UniProt ID Q9H6L2
Cytogenetics 16q23.1
Summary This gene encodes a transmembrane protein, which is a component of the B9 complex involved in the formation of the diffusion barrier between the cilia and plasma membrane. Mutations in this gene cause Joubert syndrome (JBTS). Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jan 2013]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:TMEM231 (NM_001077418) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC421412 TMEM231 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421413 TMEM231 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY421412 Transient overexpression lysate of transmembrane protein 231 (TMEM231), transcript variant 1 100 ug
$436.00
LY421413 Transient overexpression lysate of transmembrane protein 231 (TMEM231), transcript variant 2 100 ug
$436.00
TP303675 Recombinant protein of human hypothetical protein FLJ22167 (FLJ22167), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP312590 Recombinant protein of human hypothetical protein FLJ22167 (FLJ22167), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.