TMEM231 (NM_001077418) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC212590] |
Predicted MW | 35.9 kDa |
Protein Sequence |
Protein Sequence
>RC212590 representing NM_001077418
Red=Cloning site Green=Tags(s) MALYELFSHPVERSYRAGLCSKAALFLLLAAALTYIPPLLVAFRSHGFWLKRSSYEEQPTVRFQHQVLLV ALLGPESDGFLAWSTFPAFNRLQGDRLRVPLVSTREEDRNQDGKTDMLHFKLELPLQSTEHVLGVQLILT FSYRLHRMATLVMQSMAFLQSSFPVPGSQLYVNGDLRLQQKQPLSCGGLDARYNISVINGTSPFAYDYDL THIVAAYQERNVTTVLNDPNPIWLVGRAADAPFVINAIIRYPVEVISYQPGFWEMVKFAWVQYVSILLIF LWVFERIKIFVFQNQVVTTIPVTVTPRGDLCKEHLS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001070886 |
RefSeq Size | 2911 |
RefSeq ORF | 948 |
Synonyms | ALYE870; JBTS20; MKS11; PRO1886 |
Locus ID | 79583 |
UniProt ID | Q9H6L2 |
Cytogenetics | 16q23.1 |
Summary | This gene encodes a transmembrane protein, which is a component of the B9 complex involved in the formation of the diffusion barrier between the cilia and plasma membrane. Mutations in this gene cause Joubert syndrome (JBTS). Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jan 2013] |
Protein Families | Transmembrane |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC421412 | TMEM231 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC421413 | TMEM231 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY421412 | Transient overexpression lysate of transmembrane protein 231 (TMEM231), transcript variant 1 | 100 ug |
$436.00
|
|
LY421413 | Transient overexpression lysate of transmembrane protein 231 (TMEM231), transcript variant 2 | 100 ug |
$436.00
|
|
TP303675 | Recombinant protein of human hypothetical protein FLJ22167 (FLJ22167), transcript variant 3, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP312590 | Recombinant protein of human hypothetical protein FLJ22167 (FLJ22167), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.