TMEM231 Rabbit Polyclonal Antibody

SKU TA335940

Rabbit Polyclonal Anti-FLJ22167 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-FLJ22167 Antibody: synthetic peptide directed towards the N terminal of human FLJ22167. Synthetic peptide located within the following region: CHEAPRARSARAGLPNRLPTALFNSGFWLKRSSYEEQPTVRFQHQVLLVA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 36 kDa
• Gene Name: transmembrane protein 231
• Database Link:
  NP_001070886
  Q9H6L2
• Background: The function remains unknown.
• Synonyms: ALYE870; JBTS20; MKS11; PRO1886
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Mouse: 93%; Zebrafish: 79%

Reference Data

• Protein Families: Transmembrane