OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PCBP2 (NM_031989) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP300339
Recombinant protein of human poly(rC) binding protein 2 (PCBP2), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA308051 Rabbit Polyclonal antibody to PCBP2 (poly(rC) binding protein 2)
100 ul
$665.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "PCBP2 or NM_031989"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200339 protein sequence
Red=Cloning site Green=Tags(s)

MDTGVIEGGLNVTLTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGNCPERIITLAGPTNAIFK
AFAMIIDKLEEDISSSMTNSTAASRPPVTLRLVVPASQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPN
STERAITIAGIPQSIIECVKQICVVMLESPPKGVTIPYRPKPSSSPVIFAGGQDRYSTGSDSASFPHTTP
SMCLNPDLEGPPLEAYTIQGQYAIPQPDLTKLHQLAMQQSHFPMTHGNTGFSGIESSSPEVKGYWAGLDA
SAQTTSHELTIPNDLIGCIIGRQGAKINEIRQMSGAQIKIANPVEGSTDRQVTITGSAASISLAQYLINV
RLSSETGGMGSS

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 38 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_114366
Locus ID 5094
UniProt ID Q15366
Cytogenetics 12q13.13
RefSeq Size 3175
RefSeq ORF 1086
Synonyms hnRNP-E2; HNRNPE2; HNRPE2
Summary The protein encoded by this gene appears to be multifunctional. Along with PCBP-1 and hnRNPK, it is one of the major cellular poly(rC)-binding proteins. The encoded protein contains three K-homologous (KH) domains which may be involved in RNA binding. Together with PCBP-1, this protein also functions as a translational coactivator of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES, promoting poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The encoded protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability. This multiexon structural mRNA is thought to be retrotransposed to generate PCBP-1, an intronless gene with functions similar to that of PCBP2. This gene and PCBP-1 have paralogous genes (PCBP3 and PCBP4) which are thought to have arisen as a result of duplication events of entire genes. This gene also has two processed pseudogenes (PCBP2P1 and PCBP2P2). Multiple transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Jan 2018
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PCBP2" proteins (21)
SKU Description Size Price
PH300339 PCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_114366) 10 ug
$3,360.00
PH310035 PCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_005007) 10 ug
$3,360.00
PH313289 PCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_001092090) 10 ug
$3,360.00
PH325457 PCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_001122386) 10 ug
$3,360.00
PH325491 PCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_001122385) 10 ug
$3,360.00
LC403134 Lyophilized PCBP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC417574 Lyophilized PCBP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420644 Lyophilized PCBP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427015 Lyophilized PCBP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427016 Lyophilized PCBP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC429233 Lyophilized PCBP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403134 Transient overexpression lysate of poly(rC) binding protein 2 (PCBP2), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY417574 Transient overexpression lysate of poly(rC) binding protein 2 (PCBP2), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY420644 Transient overexpression lysate of poly(rC) binding protein 2 (PCBP2), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY427015 Transient overexpression lysate of poly(rC) binding protein 2 (PCBP2), transcript variant 6 (as WB positive control) 100 ug
$436.00
LY427016 Transient overexpression lysate of poly(rC) binding protein 2 (PCBP2), transcript variant 7 (as WB positive control) 100 ug
$436.00
LY429233 Transient overexpression lysate of poly(rC) binding protein 2 (PCBP2), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP310035 Recombinant protein of human poly(rC) binding protein 2 (PCBP2), transcript variant 1, 20 µg 20 ug
$737.00
TP313289 Purified recombinant protein of Homo sapiens poly(rC) binding protein 2 (PCBP2), transcript variant 3, 20 µg 20 ug
$737.00
TP325457 Purified recombinant protein of Homo sapiens poly(rC) binding protein 2 (PCBP2), transcript variant 7, 20 µg 20 ug
$737.00
TP325491 Purified recombinant protein of Homo sapiens poly(rC) binding protein 2 (PCBP2), transcript variant 6, 20 µg 20 ug
$737.00

file-alt Citations

Unique C. elegans telomeric overhang structures reveal the evolutionarily conserved properties of telomeric DNA
Školáková, Foldynová-Trantírková, Bednářová et al
Nucleic Acids Res. (2015)
Cited by 26
AI Summary: In this study, recombinant human PCBP2 protein from OriGene Technologies was used in oligonucleotide pull-down assays to investigate the structural interactions of telomeric DNA, contributing to the analysis of evolutionarily conserved properties of telomeric overhangs.
Snippet: incubated in a roller at 4°C for 1 hour. The oligonucleotide pull-down reactions were performed using recombinant human PCBP2 protein (OriGene Technologies). The mixtures of magnetic beads coupled with biotinylated DNA ... Cite SaveSaving
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products