PCBP2 (NM_001098620) Human Mass Spec Standard

SKU
PH313289
PCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_001092090)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC213289]
Predicted MW 34.7 kDa
Protein Sequence
Protein Sequence
>RC213289 representing NM_001098620
Red=Cloning site Green=Tags(s)

MDTGVIEGGLNVTLTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGNCPERIITLAGPTNAIFK
AFAMIIDKLEEDISSSMTNSTAASRPPVTLRLVVPASQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPN
STERAITIAGIPQSIIECVKQICVVMLESPPKGVTIPYRPKPSSSPVIFAGGQAYTIQGQYAIPQPDLTK
LHQLAMQQSHFPMTHGNTGFSGIESSSPEVKGYWAGLDASAQTTSHELTIPNDLIGCIIGRQGAKINEIR
QMSGAQIKIANPVEGSTDRQVTITGSAASISLAQYLINVRLSSETGGMGSS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001092090
RefSeq Size 1717
RefSeq ORF 993
Synonyms hnRNP-E2; HNRNPE2; HNRPE2
Locus ID 5094
UniProt ID Q15366
Cytogenetics 12q13.13
Summary The protein encoded by this gene appears to be multifunctional. Along with PCBP-1 and hnRNPK, it is one of the major cellular poly(rC)-binding proteins. The encoded protein contains three K-homologous (KH) domains which may be involved in RNA binding. Together with PCBP-1, this protein also functions as a translational coactivator of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES, promoting poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The encoded protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability. This multiexon structural mRNA is thought to be retrotransposed to generate PCBP-1, an intronless gene with functions similar to that of PCBP2. This gene and PCBP-1 have paralogous genes (PCBP3 and PCBP4) which are thought to have arisen as a result of duplication events of entire genes. This gene also has two processed pseudogenes (PCBP2P1 and PCBP2P2). Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2018]
Write Your Own Review
You're reviewing:PCBP2 (NM_001098620) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH300339 PCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_114366) 10 ug
$3,255.00
PH310035 PCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_005007) 10 ug
$3,255.00
PH325457 PCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_001122386) 10 ug
$3,255.00
PH325491 PCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_001122385) 10 ug
$3,255.00
LC403134 PCBP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC417574 PCBP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420644 PCBP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427015 PCBP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427016 PCBP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC429233 PCBP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403134 Transient overexpression lysate of poly(rC) binding protein 2 (PCBP2), transcript variant 2 100 ug
$436.00
LY417574 Transient overexpression lysate of poly(rC) binding protein 2 (PCBP2), transcript variant 1 100 ug
$436.00
LY420644 Transient overexpression lysate of poly(rC) binding protein 2 (PCBP2), transcript variant 3 100 ug
$436.00
LY427015 Transient overexpression lysate of poly(rC) binding protein 2 (PCBP2), transcript variant 6 100 ug
$436.00
LY427016 Transient overexpression lysate of poly(rC) binding protein 2 (PCBP2), transcript variant 7 100 ug
$436.00
LY429233 Transient overexpression lysate of poly(rC) binding protein 2 (PCBP2), transcript variant 1 100 ug
$436.00
TP300339 Recombinant protein of human poly(rC) binding protein 2 (PCBP2), transcript variant 2, 20 µg 20 ug
$737.00
TP310035 Recombinant protein of human poly(rC) binding protein 2 (PCBP2), transcript variant 1, 20 µg 20 ug
$737.00
TP313289 Purified recombinant protein of Homo sapiens poly(rC) binding protein 2 (PCBP2), transcript variant 3, 20 µg 20 ug
$737.00
TP325457 Purified recombinant protein of Homo sapiens poly(rC) binding protein 2 (PCBP2), transcript variant 7, 20 µg 20 ug
$737.00
TP325491 Purified recombinant protein of Homo sapiens poly(rC) binding protein 2 (PCBP2), transcript variant 6, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.