PCBP2 (NM_005016) Human Recombinant Protein
SKU
TP310035
Recombinant protein of human poly(rC) binding protein 2 (PCBP2), transcript variant 1, 20 µg
$737.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC210035 protein sequence
Red=Cloning site Green=Tags(s) MDTGVIEGGLNVTLTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGNCPERIITLAGPTNAIFK AFAMIIDKLEEDISSSMTNSTAASRPPVTLRLVVPASQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPN STERAITIAGIPQSIIECVKQICVVMLETLSQSPPKGVTIPYRPKPSSSPVIFAGGQDRYSTGSDSASFP HTTPSMCLNPDLEGPPLEAYTIQGQYAIPQPDLTKLHQLAMQQSHFPMTHGNTGFSGIESSSPEVKGYWA GLDASAQTTSHELTIPNDLIGCIIGRQGAKINEIRQMSGAQIKIANPVEGSTDRQVTITGSAASISLAQY LINVRLSSETGGMGSS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 38.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Bioactivity | Pull-down assay (PMID: 25855805) |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_005007 |
Locus ID | 5094 |
UniProt ID | Q15366 |
Cytogenetics | 12q13.13 |
RefSeq Size | 3187 |
RefSeq ORF | 1098 |
Synonyms | hnRNP-E2; HNRNPE2; HNRPE2 |
Summary | The protein encoded by this gene appears to be multifunctional. Along with PCBP-1 and hnRNPK, it is one of the major cellular poly(rC)-binding proteins. The encoded protein contains three K-homologous (KH) domains which may be involved in RNA binding. Together with PCBP-1, this protein also functions as a translational coactivator of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES, promoting poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The encoded protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability. This multiexon structural mRNA is thought to be retrotransposed to generate PCBP-1, an intronless gene with functions similar to that of PCBP2. This gene and PCBP-1 have paralogous genes (PCBP3 and PCBP4) which are thought to have arisen as a result of duplication events of entire genes. This gene also has two processed pseudogenes (PCBP2P1 and PCBP2P2). Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2018] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH300339 | PCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_114366) | 10 ug |
$3,255.00
|
|
PH310035 | PCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_005007) | 10 ug |
$3,255.00
|
|
PH313289 | PCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_001092090) | 10 ug |
$3,255.00
|
|
PH325457 | PCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_001122386) | 10 ug |
$3,255.00
|
|
PH325491 | PCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_001122385) | 10 ug |
$3,255.00
|
|
LC403134 | PCBP2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC417574 | PCBP2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC420644 | PCBP2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC427015 | PCBP2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC427016 | PCBP2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC429233 | PCBP2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY403134 | Transient overexpression lysate of poly(rC) binding protein 2 (PCBP2), transcript variant 2 | 100 ug |
$436.00
|
|
LY417574 | Transient overexpression lysate of poly(rC) binding protein 2 (PCBP2), transcript variant 1 | 100 ug |
$436.00
|
|
LY420644 | Transient overexpression lysate of poly(rC) binding protein 2 (PCBP2), transcript variant 3 | 100 ug |
$436.00
|
|
LY427015 | Transient overexpression lysate of poly(rC) binding protein 2 (PCBP2), transcript variant 6 | 100 ug |
$436.00
|
|
LY427016 | Transient overexpression lysate of poly(rC) binding protein 2 (PCBP2), transcript variant 7 | 100 ug |
$436.00
|
|
LY429233 | Transient overexpression lysate of poly(rC) binding protein 2 (PCBP2), transcript variant 1 | 100 ug |
$436.00
|
|
TP300339 | Recombinant protein of human poly(rC) binding protein 2 (PCBP2), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
TP313289 | Purified recombinant protein of Homo sapiens poly(rC) binding protein 2 (PCBP2), transcript variant 3, 20 µg | 20 ug |
$737.00
|
|
TP325457 | Purified recombinant protein of Homo sapiens poly(rC) binding protein 2 (PCBP2), transcript variant 7, 20 µg | 20 ug |
$737.00
|
|
TP325491 | Purified recombinant protein of Homo sapiens poly(rC) binding protein 2 (PCBP2), transcript variant 6, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.