OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

C (NC_009824) Virus Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
VC102201
Myc-DDK-tagged ORF clone of viral ORF for C [Hepatitis C virus genotype 3], codon optimized for human cell expression, YP_001491549
  $330.00
3 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (3)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00

Other products for "C Protein or NC_009824"

Specifications
Specifications
Product Data
Type Virus Tagged ORF Clone
Target Symbol C Protein
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>The Viral ORF clone VC102201 represents NCBI reference of YP_001491549 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s)

GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATGTCTACACTGCCGAAACCCCAAAGGAAAACGAAGCGAAACACTATTCGCCGACCACAGGACGTAA
AATTCCCGGGCGGAGGGCAGATTGTGGGGGGCGTGTATGTTCTGCCCAGGCGCGGGCCACGCCTTGGTGT
CAGAGCTACACGGAAGACGAGCGAACGGTCCCAGCCTCGGGGACGCAGACAGCCTATACCAAAAGCTCGC
AGATCCGAAGGCCGCTCCTGGGCTCAGCCGGGCTACCCTTGGCCCCTGTACGGGAACGAAGGCTGCGGCT
GGGCCGGATGGCTGCTTTCACCACGAGGGAGCAGACCAAGCTGGGGACCCAATGACCCACGCCGCCGGAG
CCGCAATCTGGGCAAGGTGATCGACACGCTCACATGTGGCTTCGCAGATTTGATGGGGTACATCCCCCTG
GTGGGCGCCCCCGTTGGCGGGGTGGCCAGAGCTCTGGCCCACGGCGTACGGGCGCTCGAAGATGGGATCA
ACTTTGCGACAGGCAATCTTCCCGGGTGTAGCTTTAGCATCTTCCTGCTGGCCCTCTTTAGTTGCTTGAT
CCACCCTGCTGCTTCA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>VC102201 representing YP_001491549
Red=Cloning sites Green=Tags

MMSTLPKPQRKTKRNTIRRPQDVKFPGGGQIVGGVYVLPRRGPRLGVRATRKTSERSQPRGRRQPIPKAR
RSEGRSWAQPGYPWPLYGNEGCGWAGWLLSPRGSRPSWGPNDPRRRSRNLGKVIDTLTCGFADLMGYIPL
VGAPVGGVARALAHGVRALEDGINFATGNLPGCSFSIFLLALFSCLIHPAAS

TRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-MluI Cloning Scheme for this gene |
ACCN NC_009824
ORF Size 576 bp
OTI Disclaimer The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NC_009824.1, YP_001491549
RefSeq ORF 576 bp
MW 20.9 kDa
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NC_009824" in other vectors (8)
SKU Description Size Price
VC102202 Myc-DDK-tagged ORF clone of viral ORF for E1 [Hepatitis C virus genotype 3], codon optimized for human cell expression, YP_001491550 10 ug
$330.00
VC102203 Myc-DDK-tagged ORF clone of viral ORF for E2/NS1 [Hepatitis C virus genotype 3], codon optimized for human cell expression, YP_001491551 10 ug
$503.00
VC102204 Myc-DDK-tagged ORF clone of viral ORF for NS2 [Hepatitis C virus genotype 3], codon optimized for human cell expression, YP_001491552 10 ug
$330.00
VC102205 Myc-DDK-tagged ORF clone of viral ORF for NS3 [Hepatitis C virus genotype 3], codon optimized for human cell expression, YP_001491553 10 ug
$910.00
VC102206 Myc-DDK-tagged ORF clone of viral ORF for NS4a [Hepatitis C virus genotype 3], codon optimized for human cell expression, YP_001491554 10 ug
$165.00
VC102207 Myc-DDK-tagged ORF clone of viral ORF for NS4b [Hepatitis C virus genotype 3], codon optimized for human cell expression, YP_001491555 10 ug
$330.00
VC102208 Myc-DDK-tagged ORF clone of viral ORF for NS5a [Hepatitis C virus genotype 3], codon optimized for human cell expression, YP_001491556 10 ug
$503.00
VC102209 Myc-DDK-tagged ORF clone of viral ORF for NS5b [Hepatitis C virus genotype 3], codon optimized for human cell expression, YP_001491557 10 ug
$606.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products