OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

BILF1 (NC_009334) Virus Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
VC101082
Myc-DDK-tagged ORF clone of viral ORF for BILF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129506
  $450.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (3)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00

Other products for "BILF1 or NC_009334"

Specifications
Specifications
Product Data
Type Virus Tagged ORF Clone
Target Symbol BILF1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>The Viral ORF clone VC101082 represents NCBI reference of YP_001129506 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s)

GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGTCTACTATGGCACCAGGGAGTACCGTCGGGACTCTCGTAGCCAATATGACTAGCGTGAATGCCA
CCGAGGATGCATGCACTAAGTCCTACAGTGCCTTTCTGTCAGGCATGACAAGTCTGCTTCTGGTGCTCCT
CATCTTGCTGACACTCGCTGGTATTTTGTTTATTATCTTTGTCCGGAAGCTCGTACACAGGATGGACGTG
TGGCTCATCGCCCTTCTGATAGAACTTCTGCTGTGGGTGCTCGGTAAGATGATCCAGGAATTCTCATCTA
CGGGTCTGTGCTTGCTCACTCAGAATATGATGTTTCTCGGACTGATGTGCAGCGTGTGGACACACCTGGG
CATGGCTCTCGAGAAGACCTTGGCCCTGTTTAGCAGAACCCCAAAGCGGACTAGTCACAGAAATGTGTGT
CTCTATCTGATGGGCGTGTTCTGCCTTGTCCTTCTGCTCATCATCATCCTGCTGATAACTATGGGTCCAG
ACGCTAATTTGAATAGGGGTCCCAATATGTGTAGGGAGGGTCCAACGAAAGGCATGCACACAGCTGTGCA
GGGCCTCAAAGCTGGCTGCTATCTCCTTGCTGCAGTACTGATCGTCCTCCTCACCGTTATCATTATATGG
AAACTGCTGAGAACGAAGTTCGGCCGAAAACCTCGGCTCATTTGTAATGTTACATTCACTGGACTCATCT
GCGCCTTTTCTTGGTTTATGTTGAGCCTTCCTCTTCTGTTTCTGGGGGAAGCTGGAAGTCTGGGATTTGA
CTGTACAGAGAGCCTGGTTGCTCGATACTACCCAGGCCCTGCAGCCTGTCTGGCCTTGCTGCTGATTATC
CTCTATGCATGGTCTTTTTCTCATTTTATGGACTCTCTTAAGAACCAGGTGACAGTGACCGCAAGGTATT
TCCGACGGGTACCCAGCCAGTCCACT

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>VC101082 representing YP_001129506
Red=Cloning sites Green=Tags

MLSTMAPGSTVGTLVANMTSVNATEDACTKSYSAFLSGMTSLLLVLLILLTLAGILFIIFVRKLVHRMDV
WLIALLIELLLWVLGKMIQEFSSTGLCLLTQNMMFLGLMCSVWTHLGMALEKTLALFSRTPKRTSHRNVC
LYLMGVFCLVLLLIIILLITMGPDANLNRGPNMCREGPTKGMHTAVQGLKAGCYLLAAVLIVLLTVIIIW
KLLRTKFGRKPRLICNVTFTGLICAFSWFMLSLPLLFLGEAGSLGFDCTESLVARYYPGPAACLALLLII
LYAWSFSHFMDSLKNQVTVTARYFRRVPSQST

TRTRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene |
ACCN NC_009334
ORF Size 936 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NC_009334.1, YP_001129506
RefSeq ORF 936 bp
Locus ID 5176230
MW 34.5 kDa
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NC_009334" in other vectors (71)
SKU Description Size Price
VC101013 Myc-DDK-tagged ORF clone of viral ORF for BNRF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129438 10 ug
$1,262.00
VC101014 Myc-DDK-tagged ORF clone of viral ORF for K15 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129436 10 ug
$503.00
VC101015 Myc-DDK-tagged ORF clone of viral ORF for BFLF2 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129443 10 ug
$330.00
VC101016 Myc-DDK-tagged ORF clone of viral ORF for LMP-2B [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129437 10 ug
$503.00
VC101017 Myc-DDK-tagged ORF clone of viral ORF for BCRF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129439 10 ug
$330.00
VC101019 Myc-DDK-tagged ORF clone of viral ORF for EBNA-2 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129441 10 ug
$289.00 $503.00
VC101020 Myc-DDK-tagged ORF clone of viral ORF for BHRF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129442 10 ug
$330.00
VC101021 Myc-DDK-tagged ORF clone of viral ORF for BFLF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129444 10 ug
$538.00
VC101022 Myc-DDK-tagged ORF clone of viral ORF for BFRF1A [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129445 10 ug
$165.00
VC101023 Myc-DDK-tagged ORF clone of viral ORF for BFRF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129446 10 ug
$503.00
VC101024 Myc-DDK-tagged ORF clone of viral ORF for BFRF2 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129447 10 ug
$605.00
VC101025 Myc-DDK-tagged ORF clone of viral ORF for BFRF3 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129448 10 ug
$330.00
VC101028 Myc-DDK-tagged ORF clone of viral ORF for BORF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129451 10 ug
$503.00
VC101029 Myc-DDK-tagged ORF clone of viral ORF for BORF2 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129452 10 ug
$832.00
VC101030 Myc-DDK-tagged ORF clone of viral ORF for BaRF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129453 10 ug
$330.00
VC101031 Myc-DDK-tagged ORF clone of viral ORF for BMRF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129454 10 ug
$503.00
VC101032 Myc-DDK-tagged ORF clone of viral ORF for BMRF2 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129455 10 ug
$503.00
VC101033 Myc-DDK-tagged ORF clone of viral ORF for BSLF2/BMLF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129456 10 ug
$289.00 $457.00
VC101034 Myc-DDK-tagged ORF clone of viral ORF for BSLF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129457 10 ug
$880.00
VC101035 Myc-DDK-tagged ORF clone of viral ORF for BSRF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129458 10 ug
$330.00
VC101036 Myc-DDK-tagged ORF clone of viral ORF for BLLF3 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129459 10 ug
$330.00
VC101037 Myc-DDK-tagged ORF clone of viral ORF for BLRF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129460 10 ug
$165.00
VC101038 Myc-DDK-tagged ORF clone of viral ORF for BLRF2 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129461 10 ug
$165.00
VC101040 Myc-DDK-tagged ORF clone of viral ORF for EBNA-3A [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129463 10 ug
$589.00 $847.00
VC101043 Myc-DDK-tagged ORF clone of viral ORF for BZLF2 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129466 10 ug
$330.00
VC101044 Myc-DDK-tagged ORF clone of viral ORF for BRLF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129468 10 ug
$289.00 $619.00
VC101045 Myc-DDK-tagged ORF clone of viral ORF for BZLF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129467 10 ug
$450.00
VC101046 Myc-DDK-tagged ORF clone of viral ORF for BRRF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129469 10 ug
$330.00
VC101047 Myc-DDK-tagged ORF clone of viral ORF for BRRF2 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129470 10 ug
$550.00
VC101049 Myc-DDK-tagged ORF clone of viral ORF for BKRF2 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129472 10 ug
$165.00
VC101050 Myc-DDK-tagged ORF clone of viral ORF for BKRF3 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129473 10 ug
$330.00
VC101051 Myc-DDK-tagged ORF clone of viral ORF for BKRF4 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129474 10 ug
$330.00
VC101052 Myc-DDK-tagged ORF clone of viral ORF for BBLF4 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129475 10 ug
$815.00
VC101053 Myc-DDK-tagged ORF clone of viral ORF for BBRF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129476 10 ug
$628.00
VC101054 Myc-DDK-tagged ORF clone of viral ORF for BBRF2 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129477 10 ug
$330.00
VC101055 Myc-DDK-tagged ORF clone of viral ORF for BBLF2/BBLF3 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129478 10 ug
$714.00
VC101056 Myc-DDK-tagged ORF clone of viral ORF for BBRF3 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129479 10 ug
$503.00
VC101057 Myc-DDK-tagged ORF clone of viral ORF for BBLF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129480 10 ug
$165.00
VC101058 Myc-DDK-tagged ORF clone of viral ORF for BGLF5 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129481 10 ug
$503.00
VC101059 Myc-DDK-tagged ORF clone of viral ORF for BGLF4 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129482 10 ug
$503.00
VC101060 Myc-DDK-tagged ORF clone of viral ORF for BGLF35 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129483 10 ug
$165.00
VC101061 Myc-DDK-tagged ORF clone of viral ORF for BGRF1/BDRF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129485 10 ug
$695.00
VC101062 Myc-DDK-tagged ORF clone of viral ORF for BGLF2 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129486 10 ug
$503.00
VC101063 Myc-DDK-tagged ORF clone of viral ORF for BGLF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129487 10 ug
$518.00
VC101064 Myc-DDK-tagged ORF clone of viral ORF for BGLF3 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129484 10 ug
$450.00
VC101065 Myc-DDK-tagged ORF clone of viral ORF for BDLF4 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129488 10 ug
$480.00
VC101066 Myc-DDK-tagged ORF clone of viral ORF for BDLF35 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129489 10 ug
$165.00
VC101067 Myc-DDK-tagged ORF clone of viral ORF for BDLF3 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129490 10 ug
$330.00
VC101068 Myc-DDK-tagged ORF clone of viral ORF for BDLF2 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129491 10 ug
$503.00
VC101069 Myc-DDK-tagged ORF clone of viral ORF for BDLF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129492 10 ug
$330.00
VC101070 Myc-DDK-tagged ORF clone of viral ORF for BcLF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129493 10 ug
$1,299.00
VC101071 Myc-DDK-tagged ORF clone of viral ORF for BcRF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129494 10 ug
$755.00
VC101072 Myc-DDK-tagged ORF clone of viral ORF for BTRF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129495 10 ug
$503.00
VC101073 Myc-DDK-tagged ORF clone of viral ORF for BXLF2 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129496 10 ug
$711.00
VC101074 Myc-DDK-tagged ORF clone of viral ORF for BXLF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129497 10 ug
$621.00
VC101075 Myc-DDK-tagged ORF clone of viral ORF for BXRF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129498 10 ug
$330.00
VC101076 Myc-DDK-tagged ORF clone of viral ORF for BVRF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129499 10 ug
$584.00
VC101077 Myc-DDK-tagged ORF clone of viral ORF for BVRF2 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129501 10 ug
$619.00
VC101078 Myc-DDK-tagged ORF clone of viral ORF for BdRF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129502 10 ug
$503.00
VC101079 Myc-DDK-tagged ORF clone of viral ORF for BILF2 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129503 10 ug
$330.00
VC101080 Myc-DDK-tagged ORF clone of viral ORF for LF2 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129504 10 ug
$503.00
VC101081 Myc-DDK-tagged ORF clone of viral ORF for LF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129505 10 ug
$503.00
VC101083 Myc-DDK-tagged ORF clone of viral ORF for BALF5 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129507 10 ug
$972.00
VC101084 Myc-DDK-tagged ORF clone of viral ORF for BALF4 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129508 10 ug
$863.00
VC101085 Myc-DDK-tagged ORF clone of viral ORF for BALF3 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129509 10 ug
$690.00
VC101086 Myc-DDK-tagged ORF clone of viral ORF for BALF2 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129510 10 ug
$1,080.00
VC101087 Myc-DDK-tagged ORF clone of viral ORF for BALF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129511 10 ug
$330.00
VC101088 Myc-DDK-tagged ORF clone of viral ORF for BARF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129512 10 ug
$330.00
VC101089 Myc-DDK-tagged ORF clone of viral ORF for BNLF2b [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129513 10 ug
$165.00
VC101090 Myc-DDK-tagged ORF clone of viral ORF for BNLF2a [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129514 10 ug
$165.00
VC101092 Myc-DDK-tagged ORF clone of viral ORF for BVLF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129500 10 ug
$450.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products