OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

single-stranded DNA binding protein (NC_009334) Virus Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
VC101086
Myc-DDK-tagged ORF clone of viral ORF for BALF2 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129510
  $1,080.00
6 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (3)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00

Other products for "single-stranded DNA binding protein or NC_009334"

Specifications
Specifications
Product Data
Type Virus Tagged ORF Clone
Target Symbol single-stranded DNA binding protein
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>The Viral ORF clone VC101086 represents NCBI reference of YP_001129510 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s)

GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGGGGGCGCAAACTTCAGAGGACAATCTGGGCTCTCAGTCACAACCTGGACCCTGTGGATACATTT
ATTTCTATCCTCTGGCTACTTATCCACTCCGGGAAGTGGCTACCCTCGGGACCGGCTATGCAGGACATCG
ATGTCTGACTGTCCCACTGCTTTGCGGGATTACCGTCGAGCCCGGCTTTAGCATAAACGTGAAAGCCTTG
CATCGGCGACCTGATCCAAACTGCGGGCTCCTCCGAGCGACCTCTTACCACAGAGATATCTATGTGTTTC
ACAATGCCCACATGGTTCCTCCCATCTTTGAAGGGCCTGGTCTGGAGGCCCTGTGCGGAGAGACTCGCGA
GGTATTTGGTTACGATGCTTACTCCGCCCTCCCGCGAGAGAGCTCAGAACCTGGCGATTTTTTCCCTGAG
GGATTGGACCCATCCGCGTACTTGGGAGCCGTTGCTATCACGGAGGCCTTTAAGGAGAGACTGTATTCCG
GGAATCTTGTCGCCATCCCATCTCTGAAGCAAGAGGTGGCCGTGGGTCAGAGCGCATCCGTGCGGGTGCC
TCTTTACGATAAAGAAGTGTTCCCTGAAGGGGTGCCCCAGCTGAGACAGTTCTATAATTCCGATCTGTCT
CGCTGCATGCACGAAGCTTTGTACACTGGCCTCGCACAGGCACTCCGCGTACGGCGCGTGGGTAAACTGG
TCGAGCTGCTGGAAAAGCAAAGTCTCCAGGATCAGGCCAAAGTTGCCAAGGTGGCTCCACTGAAAGAGTT
CCCCGCAAGTACAATATCTCATCCGGATAGTGGCGCACTCATGATTGTCGATTCTGCCGCTTGCGAACTT
GCAGTCTCTTACGCCCCTGCCATGCTCGAAGCATCCCATGAGACTCCCGCCTCCCTTAATTACGACTCCT
GGCCATTGTTCGCTGATTGTGAGGGACCAGAAGCCCGCGTCGCAGCTCTCCACCGGTACAACGCTAGCCT
GGCCCCGCATGTGAGCACCCAGATTTTTGCTACCAACTCCGTGCTGTACGTCAGTGGGGTATCCAAGAGC
ACAGGGCAGGGAAAGGAGAGTCTGTTCAACAGCTTCTACATGACACACGGATTGGGCACTCTTCAAGAAG
GCACATGGGACCCCTGTAGAAGGCCCTGCTTTAGTGGATGGGGCGGACCTGATGTGACTGGGACTAATGG
CCCAGGGAACTACGCCGTGGAGCATCTGGTATATGCCGCTAGTTTCTCCCCCAACTTGCTGGCCCGGTAT
GCATACTACCTGCAGTTCTGTCAAGGACAAAAGAGTTCTTTGACCCCTGTACCCGAGACAGGCTCCTACG
TGGCGGGGGCTGCTGCTTCACCCATGTGTTCCTTGTGTGAGGGTCGAGCGCCTGCAGTTTGTCTGAATAC
CCTGTTTTTCCGCTTGCGCGATAGATTCCCGCCAGTCATGTCAACTCAACGGCGCGACCCCTATGTTATA
AGCGGGGCATCTGGGTCTTACAATGAAACCGACTTTCTGGGTAATTTTCTGAATTTTATCGATAAGGAAG
ATGATGGCCAGAGACCAGATGATGAACCACGGTACACCTACTGGCAACTGAACCAGAATCTGCTGGAAAG
GCTGAGTCGCCTTGGTATTGACGCTGAAGGGAAGCTCGAGAAAGAGCCACATGGACCTCGAGACTTCGTC
AAGATGTTCAAGGATGTAGACGCTGCAGTAGATGCCGAAGTGGTGCAATTTATGAACAGCATGGCAAAGA
ATAACATTACCTACAAAGATCTGGTGAAGAGCTGCTACCATGTTATGCAGTACTCATGCAACCCATTCGC
ACAACCTGCTTGTCCTATTTTTACTCAGCTCTTCTACCGCAGCCTTCTCACCATCCTGCAGGACATATCC
CTGCCTATCTGTATGTGCTACGAAAACGATAATCCAGGGCTGGGCCAGTCTCCGCCAGAGTGGTTGAAGG
GCCACTATCAGACCTTGTGTACTAATTTTAGAAGTCTCGCAATTGACAAGGGCGTTCTCACAGCAAAGGA
AGCAAAGGTGGTCCACGGCGAGCCAACATGTGACTTGCCTGACCTTGACGCCGCGCTGCAGGGACGAGTC
TATGGACGCAGACTGCCTGTTCGCATGAGTAAAGTTCTCATGCTGTGCCCACGGAATATTAAAATCAAAA
ACCGCGTTGTGTTTACCGGAGAAAACGCCGCTCTTCAGAATTCCTTCATCAAGTCCACAACCCGGAGAGA
GAATTATATCATCAACGGCCCATATATGAAGTTTCTGAACACTTACCACAAAACGCTCTTCCCTGACACT
AAGCTCTCAAGCCTCTACCTTTGGCACAATTTTTCACGGAGAAGAAGCGTCCCCGTGCCATCAGGAGCAA
GTGCCGAAGAGTATAGCGACTTGGCTCTCTTTGTAGATGGCGGGTCAAGGGCTCATGAGGAGAGCAATGT
TATCGATGTCGTCCCTGGGAACTTGGTAACATACGCTAAGCAGCGCTTGAACAACGCAATTCTTAAAGCA
TGCGGGCAGACCCAATTCTACATCTCCCTCATCCAGGGTTTGGTTCCCAGAACACAATCCGTGCCCGCCC
GCGACTACCCCCACGTTCTCGGAACCCGGGCTGTCGAGTCCGCTGCTGCCTACGCTGAAGCCACCTCAAG
CTTGACAGCCACCACGGTAGTGTGTGCAGCTACGGACTGTCTTTCACAGGTCTGTAAAGCGCGGCCTGTG
GTCACCCTGCCGGTGACGATAAATAAGTACACCGGCGTGAACGGCAATAACCAAATTTTCCAGGCCGGTA
ATCTCGGATATTTCATGGGAAGAGGAGTTGACAGGAATCTGCTGCAGGCCCCCGGCGCAGGGCTGCGCAA
ACAGGCAGGGGGTTCCTCAATGAGGAAAAAGTTCGTATTCGCTACCCCTACATTGGGTTTGACTGTGAAG
CGACGGACTCAAGCCGCCACCACCTACGAAATTGAAAATATCCGGGCTGGACTTGAGGCTATCATCAGTC
AAAAACAGGAGGAGGACTGTGTTTTCGACGTAGTTTGTAATCTCGTTGACGCGATGGGGGAAGCCTGCGC
CTCCCTTACGCGGGACGATGCCGAATATCTGCTGGGTCGCTTTTCTGTTCTCGCAGATAGTGTGCTTGAA
ACACTCGCTACGATCGCATCAAGCGGGATCGAATGGACCGCCGGCGCTGCCCGAGACTTTCTCGAGGGGG
TGTGGGGGGGTCCAGGCGCAGCGCAAGATAATTTCATTTCTGTGGCTGAACCTGTTTCAACCGCAAGCCA
GGCTAGTGCAGGCCTCCTGCTGGGAGGAGGCGGGCAGGGGAGCGGAGGCAGGAGAAAACGACGGCTGGCC
ACAGTCCTGCCTGGCTTGGAAGTT

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>VC101086 representing YP_001129510
Red=Cloning sites Green=Tags

MQGAQTSEDNLGSQSQPGPCGYIYFYPLATYPLREVATLGTGYAGHRCLTVPLLCGITVEPGFSINVKAL
HRRPDPNCGLLRATSYHRDIYVFHNAHMVPPIFEGPGLEALCGETREVFGYDAYSALPRESSEPGDFFPE
GLDPSAYLGAVAITEAFKERLYSGNLVAIPSLKQEVAVGQSASVRVPLYDKEVFPEGVPQLRQFYNSDLS
RCMHEALYTGLAQALRVRRVGKLVELLEKQSLQDQAKVAKVAPLKEFPASTISHPDSGALMIVDSAACEL
AVSYAPAMLEASHETPASLNYDSWPLFADCEGPEARVAALHRYNASLAPHVSTQIFATNSVLYVSGVSKS
TGQGKESLFNSFYMTHGLGTLQEGTWDPCRRPCFSGWGGPDVTGTNGPGNYAVEHLVYAASFSPNLLARY
AYYLQFCQGQKSSLTPVPETGSYVAGAAASPMCSLCEGRAPAVCLNTLFFRLRDRFPPVMSTQRRDPYVI
SGASGSYNETDFLGNFLNFIDKEDDGQRPDDEPRYTYWQLNQNLLERLSRLGIDAEGKLEKEPHGPRDFV
KMFKDVDAAVDAEVVQFMNSMAKNNITYKDLVKSCYHVMQYSCNPFAQPACPIFTQLFYRSLLTILQDIS
LPICMCYENDNPGLGQSPPEWLKGHYQTLCTNFRSLAIDKGVLTAKEAKVVHGEPTCDLPDLDAALQGRV
YGRRLPVRMSKVLMLCPRNIKIKNRVVFTGENAALQNSFIKSTTRRENYIINGPYMKFLNTYHKTLFPDT
KLSSLYLWHNFSRRRSVPVPSGASAEEYSDLALFVDGGSRAHEESNVIDVVPGNLVTYAKQRLNNAILKA
CGQTQFYISLIQGLVPRTQSVPARDYPHVLGTRAVESAAAYAEATSSLTATTVVCAATDCLSQVCKARPV
VTLPVTINKYTGVNGNNQIFQAGNLGYFMGRGVDRNLLQAPGAGLRKQAGGSSMRKKFVFATPTLGLTVK
RRTQAATTYEIENIRAGLEAIISQKQEEDCVFDVVCNLVDAMGEACASLTRDDAEYLLGRFSVLADSVLE
TLATIASSGIEWTAGAARDFLEGVWGGPGAAQDNFISVAEPVSTASQASAGLLLGGGGQGSGGRRKRRLA
TVLPGLEV

TRTRRLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-MluI Cloning Scheme for this gene |
ACCN NC_009334
ORF Size 3384 bp
OTI Disclaimer The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decoded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NC_009334.1, YP_001129510
RefSeq ORF 3384 bp
Locus ID 5176206
MW 123.1 kDa
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NC_009334" in other vectors (71)
SKU Description Size Price
VC101013 Myc-DDK-tagged ORF clone of viral ORF for BNRF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129438 10 ug
$1,262.00
VC101014 Myc-DDK-tagged ORF clone of viral ORF for K15 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129436 10 ug
$503.00
VC101015 Myc-DDK-tagged ORF clone of viral ORF for BFLF2 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129443 10 ug
$330.00
VC101016 Myc-DDK-tagged ORF clone of viral ORF for LMP-2B [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129437 10 ug
$503.00
VC101017 Myc-DDK-tagged ORF clone of viral ORF for BCRF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129439 10 ug
$330.00
VC101019 Myc-DDK-tagged ORF clone of viral ORF for EBNA-2 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129441 10 ug
$289.00 $503.00
VC101020 Myc-DDK-tagged ORF clone of viral ORF for BHRF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129442 10 ug
$330.00
VC101021 Myc-DDK-tagged ORF clone of viral ORF for BFLF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129444 10 ug
$538.00
VC101022 Myc-DDK-tagged ORF clone of viral ORF for BFRF1A [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129445 10 ug
$165.00
VC101023 Myc-DDK-tagged ORF clone of viral ORF for BFRF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129446 10 ug
$503.00
VC101024 Myc-DDK-tagged ORF clone of viral ORF for BFRF2 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129447 10 ug
$605.00
VC101025 Myc-DDK-tagged ORF clone of viral ORF for BFRF3 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129448 10 ug
$330.00
VC101028 Myc-DDK-tagged ORF clone of viral ORF for BORF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129451 10 ug
$503.00
VC101029 Myc-DDK-tagged ORF clone of viral ORF for BORF2 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129452 10 ug
$832.00
VC101030 Myc-DDK-tagged ORF clone of viral ORF for BaRF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129453 10 ug
$330.00
VC101031 Myc-DDK-tagged ORF clone of viral ORF for BMRF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129454 10 ug
$503.00
VC101032 Myc-DDK-tagged ORF clone of viral ORF for BMRF2 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129455 10 ug
$503.00
VC101033 Myc-DDK-tagged ORF clone of viral ORF for BSLF2/BMLF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129456 10 ug
$289.00 $457.00
VC101034 Myc-DDK-tagged ORF clone of viral ORF for BSLF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129457 10 ug
$880.00
VC101035 Myc-DDK-tagged ORF clone of viral ORF for BSRF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129458 10 ug
$330.00
VC101036 Myc-DDK-tagged ORF clone of viral ORF for BLLF3 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129459 10 ug
$330.00
VC101037 Myc-DDK-tagged ORF clone of viral ORF for BLRF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129460 10 ug
$165.00
VC101038 Myc-DDK-tagged ORF clone of viral ORF for BLRF2 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129461 10 ug
$165.00
VC101040 Myc-DDK-tagged ORF clone of viral ORF for EBNA-3A [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129463 10 ug
$589.00 $847.00
VC101043 Myc-DDK-tagged ORF clone of viral ORF for BZLF2 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129466 10 ug
$330.00
VC101044 Myc-DDK-tagged ORF clone of viral ORF for BRLF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129468 10 ug
$289.00 $619.00
VC101045 Myc-DDK-tagged ORF clone of viral ORF for BZLF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129467 10 ug
$450.00
VC101046 Myc-DDK-tagged ORF clone of viral ORF for BRRF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129469 10 ug
$330.00
VC101047 Myc-DDK-tagged ORF clone of viral ORF for BRRF2 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129470 10 ug
$550.00
VC101049 Myc-DDK-tagged ORF clone of viral ORF for BKRF2 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129472 10 ug
$165.00
VC101050 Myc-DDK-tagged ORF clone of viral ORF for BKRF3 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129473 10 ug
$330.00
VC101051 Myc-DDK-tagged ORF clone of viral ORF for BKRF4 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129474 10 ug
$330.00
VC101052 Myc-DDK-tagged ORF clone of viral ORF for BBLF4 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129475 10 ug
$815.00
VC101053 Myc-DDK-tagged ORF clone of viral ORF for BBRF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129476 10 ug
$628.00
VC101054 Myc-DDK-tagged ORF clone of viral ORF for BBRF2 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129477 10 ug
$330.00
VC101055 Myc-DDK-tagged ORF clone of viral ORF for BBLF2/BBLF3 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129478 10 ug
$714.00
VC101056 Myc-DDK-tagged ORF clone of viral ORF for BBRF3 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129479 10 ug
$503.00
VC101057 Myc-DDK-tagged ORF clone of viral ORF for BBLF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129480 10 ug
$165.00
VC101058 Myc-DDK-tagged ORF clone of viral ORF for BGLF5 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129481 10 ug
$503.00
VC101059 Myc-DDK-tagged ORF clone of viral ORF for BGLF4 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129482 10 ug
$503.00
VC101060 Myc-DDK-tagged ORF clone of viral ORF for BGLF35 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129483 10 ug
$165.00
VC101061 Myc-DDK-tagged ORF clone of viral ORF for BGRF1/BDRF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129485 10 ug
$695.00
VC101062 Myc-DDK-tagged ORF clone of viral ORF for BGLF2 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129486 10 ug
$503.00
VC101063 Myc-DDK-tagged ORF clone of viral ORF for BGLF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129487 10 ug
$518.00
VC101064 Myc-DDK-tagged ORF clone of viral ORF for BGLF3 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129484 10 ug
$450.00
VC101065 Myc-DDK-tagged ORF clone of viral ORF for BDLF4 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129488 10 ug
$480.00
VC101066 Myc-DDK-tagged ORF clone of viral ORF for BDLF35 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129489 10 ug
$165.00
VC101067 Myc-DDK-tagged ORF clone of viral ORF for BDLF3 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129490 10 ug
$330.00
VC101068 Myc-DDK-tagged ORF clone of viral ORF for BDLF2 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129491 10 ug
$503.00
VC101069 Myc-DDK-tagged ORF clone of viral ORF for BDLF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129492 10 ug
$330.00
VC101070 Myc-DDK-tagged ORF clone of viral ORF for BcLF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129493 10 ug
$1,299.00
VC101071 Myc-DDK-tagged ORF clone of viral ORF for BcRF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129494 10 ug
$755.00
VC101072 Myc-DDK-tagged ORF clone of viral ORF for BTRF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129495 10 ug
$503.00
VC101073 Myc-DDK-tagged ORF clone of viral ORF for BXLF2 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129496 10 ug
$711.00
VC101074 Myc-DDK-tagged ORF clone of viral ORF for BXLF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129497 10 ug
$621.00
VC101075 Myc-DDK-tagged ORF clone of viral ORF for BXRF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129498 10 ug
$330.00
VC101076 Myc-DDK-tagged ORF clone of viral ORF for BVRF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129499 10 ug
$584.00
VC101077 Myc-DDK-tagged ORF clone of viral ORF for BVRF2 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129501 10 ug
$619.00
VC101078 Myc-DDK-tagged ORF clone of viral ORF for BdRF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129502 10 ug
$503.00
VC101079 Myc-DDK-tagged ORF clone of viral ORF for BILF2 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129503 10 ug
$330.00
VC101080 Myc-DDK-tagged ORF clone of viral ORF for LF2 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129504 10 ug
$503.00
VC101081 Myc-DDK-tagged ORF clone of viral ORF for LF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129505 10 ug
$503.00
VC101082 Myc-DDK-tagged ORF clone of viral ORF for BILF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129506 10 ug
$450.00
VC101083 Myc-DDK-tagged ORF clone of viral ORF for BALF5 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129507 10 ug
$972.00
VC101084 Myc-DDK-tagged ORF clone of viral ORF for BALF4 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129508 10 ug
$863.00
VC101085 Myc-DDK-tagged ORF clone of viral ORF for BALF3 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129509 10 ug
$690.00
VC101087 Myc-DDK-tagged ORF clone of viral ORF for BALF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129511 10 ug
$330.00
VC101088 Myc-DDK-tagged ORF clone of viral ORF for BARF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129512 10 ug
$330.00
VC101089 Myc-DDK-tagged ORF clone of viral ORF for BNLF2b [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129513 10 ug
$165.00
VC101090 Myc-DDK-tagged ORF clone of viral ORF for BNLF2a [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129514 10 ug
$165.00
VC101092 Myc-DDK-tagged ORF clone of viral ORF for BVLF1 [Human herpesvirus 4 type 2], codon optimized for human cell expression, YP_001129500 10 ug
$450.00

file-alt Citations

Molecular Mechanisms for Species Differences in Organic Anion Transporter 1, OAT1: Implications for Renal Drug Toxicity
Zou, Stecula, Gupta et al
Mol. Pharmacol. (2018) 94 (1), 689-699 DOI: 10.1124/mol.117.111153
AI Summary: OriGene contributed mouse Oat1 cDNA clones (catalog number BC021647.1) used for amplifying and studying species-specific differences in OAT1 function in this research.
Snippet: from corresponding species. The coding regions of mouse Oat1 (BC021647.1) were amplified from cDNA clones purchased from OriGene (Rockville, MD). The coding sequences of OAT1 from chimpanzee (XM_001160252 View as HTML
Genomic deletion of malic enzyme 2 confers collateral lethality in pancreatic cancer
Dey, Baddour, Muller et al
Nature (2017)
AI Summary: OriGene contributed a human C-terminal GFP-tagged GPR19 clone (product RG220379), which was used in the study to investigate the role of specific genes in pancreatic cancer cell metabolism.
Snippet: In vitrogen GPCR clone catalog numbers are as follows: IOH29586 (PRH LR) and IOH28333 (T AAR1). The human C-terminal GFP-tagged GPR19 clone was from OriGene (RG220379)
Prdm4 induction by the small molecule butein promotes white adipose tissue browning
Song, Choi, Rajbhandari et al
Nat. Chem. Biol. (2016)
Cited by 53
AI Summary: OriGene’s PRDM4 ORF cDNA clones were used in this study to overexpress PRDM4 in cell lines, enabling the investigation of PRDM4’s role in promoting white adipose tissue browning.
Snippet: Overexpression and knockdown studies. PRDM4 ORF cDNA clones were purchased from Origene. The PRDM4 ORF was cloned into pcDNA3.1 and transfected into 3T3-L1 and C3H10T1/2 cells for overexpression of PRDM4. ... Cite SaveSaving
Androgen Receptor-Mediated Growth Suppression of HPr-1AR and PC3-Lenti-AR Prostate Epithelial Cells
Kim, Chen, Bolton
PLoS ONE (2015) 10 (9), e0138286 DOI: 10.1371/journal.pone.0138286
Cited by 12
AI Summary: OriGene cDNA clones for CDK4, CDK6, and CDKN1A were used as templates to amplify the full-length coding regions of these genes, enabling their functional analysis in the study of androgen receptor-mediated growth suppression in prostate epithelial cells.
Snippet: Full-length CDK4, CDK6, and CDKN1A protein coding regions were amplified from HPr-1AR cDNA or OriGene cDNA clones (OriGene Technologies, Rockville, MD) using PCR, and they were inserted into the EcoR I and BamH I sites of pBEC127, generating pBEC128 ... Cite SaveSaving
FigureFigureFigure
Cellular mRNAs access second ORFs using a novel amino acid sequence-dependent coupled translation termination-reinitiation mechanism
Gould, Dyer, Croft et al
RNA (2014)
Cited by 23
AI Summary: OriGene contributed to this study by providing cDNA clones of genes of interest, which were used to investigate the translation mechanisms described in the paper.
Snippet: The cDNA clones of the genes of interest were obtained from commercial suppliers (Origene or Source Bioscience IMAGE clones) or synthesized from cDNA generated from HEp2 cell lines in our laboratory using stan-dard protocols
MYC/MAX control ERK signaling and pluripotency by regulation of dual-specificity phosphatases 2 and 7
Chappell, Sun, Singh et al
Genes Dev. (2013) 27 (7), 725-33 DOI: 10.1101/gad.211300.112
Cited by 77
AI Summary: OriGene cDNA clones for DUSP2, DUSP7, and ERK2(D319N) were used to generate expression constructs, enabling the authors to study how MYC/MAX complexes regulate ERK signaling and pluripotency through these genes.
Snippet: DUSP2-HA, DUSP7-HA, and ERK2(D319N) fragments were cloned from cDNA clones (Origene) and placed under the control of a Tet-inducible promoter from pLVX-tight-puro (Clontech, PT3996-5). In the absence of Tet-express, pLVX-tight-puro provides very low background
Showing 1-6 of 13 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products