OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NADPH oxidase 4 (NOX4) (NM_016931) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RG208007
NOX4 (tGFP-tagged) - Human NADPH oxidase 4 (NOX4), transcript variant 1
ORF Plasmid:
tGFP DDK
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
$489.00 $738.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA349083 Rabbit Polyclonal Anti-NOX4 Antibody
100 ug
$640.00
TA150041 Mouse monoclonal turboGFP antibody, clone OTI2H8 100 ul
$447.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100010 pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
10 ug
$780.00

Other products for "NADPH oxidase 4 or NM_016931"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol NADPH oxidase 4
Synonyms KOX; KOX-1; RENOX
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG208007 representing NM_016931
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGTGTCCTGGAGGAGCTGGCTCGCCAACGAAGGGGTTAAACACCTCTGCCTGTTCATCTGGCTCT
CCATGAATGTCCTGCTTTTCTGGAAAACCTTCTTGCTGTATAACCAAGGGCCAGAGTATCACTACCTCCA
CCAGATGTTGGGGCTAGGATTGTGTCTAAGCAGAGCCTCAGCATCTGTTCTTAACCTCAACTGCAGCCTT
ATCCTTTTACCCATGTGCCGAACACTCTTGGCTTACCTCCGAGGATCACAGAAGGTTCCAAGCAGGAGAA
CCAGGAGATTGTTGGATAAAAGCAGAACATTCCATATTACCTGTGGTGTTACTATCTGTATTTTCTCAGG
CGTGCATGTGGCTGCCCATCTGGTGAATGCCCTCAACTTCTCAGTGAATTACAGTGAAGACTTTGTTGAA
CTGAATGCAGCAAGATACCGAGATGAGGATCCTAGAAAACTTCTCTTCACAACTGTTCCTGGCCTGACAG
GGGTCTGCATGGTGGTGGTGCTATTCCTCATGATCACAGCCTCTACATATGCAATAAGAGTTTCTAACTA
TGATATCTTCTGGTATACTCATAACCTCTTCTTTGTCTTCTACATGCTGCTGACGTTGCATGTTTCAGGA
GGGCTGCTGAAGTATCAAACTAATTTAGATACCCACCCTCCCGGCTGCATCAGTCTTAACCGAACCAGCT
CTCAGAATATTTCCTTACCAGAGTATTTCTCAGAACATTTTCATGAACCTTTCCCTGAAGGATTTTCAAA
ACCGGCAGAGTTTACCCAGCACAAATTTGTGAAGATTTGTATGGAAGAGCCCAGATTCCAAGCTAATTTT
CCACAGACTTGGCTTTGGATTTCTGGACCTTTGTGCCTGTACTGTGCCGAAAGACTTTACAGGTATATCC
GGAGCAATAAGCCAGTCACCATCATTTCGGTCATAAGTCATCCCTCAGATGTCATGGAAATCCGAATGGT
CAAAGAAAATTTTAAAGCAAGACCTGGTCAGTATATTACTCTACATTGTCCCAGTGTATCTGCATTAGAA
AATCATCCATTTACCCTCACAATGTGTCCAACTGAAACCAAAGCAACATTTGGGGTTCATCTTAAAATAG
TAGGAGACTGGACAGAACGATTTCGAGATTTACTACTGCCTCCATCTAGTCAAGACTCCGAAATTCTGCC
CTTCATTCAATCTAGAAATTATCCCAAGCTGTATATTGATGGTCCTTTTGGAAGTCCATTTGAGGAATCA
CTGAACTATGAGGTCAGCCTCTGCGTGGCTGGAGGCATTGGAGTAACTCCATTTGCATCAATACTCAACA
CCCTGTTGGATGACTGGAAACCATACAAGCTTAGAAGACTATACTTTATTTGGGTATGCAGAGATATCCA
GTCCTTCCGTTGGTTTGCAGATTTACTCTGTATGTTGCATAACAAGTTTTGGCAAGAGAACAGACCTGAC
TATGTCAACATCCAGCTGTACCTCAGTCAAACAGATGGGATACAGAAGATAATTGGAGAAAAATATCATG
CACTGAATTCAAGACTGTTTATAGGACGTCCTCGGTGGAAACTTTTGTTTGATGAAATAGCAAAATATAA
CAGAGGAAAAACAGTTGGTGTTTTCTGTTGTGGACCCAATTCACTATCCAAGACTCTTCATAAACTGAGT
AACCAGAACAACTCATATGGGACAAGATTTGAATACAATAAAGAGTCTTTCAGC

ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG208007 representing NM_016931
Red=Cloning site Green=Tags(s)

MAVSWRSWLANEGVKHLCLFIWLSMNVLLFWKTFLLYNQGPEYHYLHQMLGLGLCLSRASASVLNLNCSL
ILLPMCRTLLAYLRGSQKVPSRRTRRLLDKSRTFHITCGVTICIFSGVHVAAHLVNALNFSVNYSEDFVE
LNAARYRDEDPRKLLFTTVPGLTGVCMVVVLFLMITASTYAIRVSNYDIFWYTHNLFFVFYMLLTLHVSG
GLLKYQTNLDTHPPGCISLNRTSSQNISLPEYFSEHFHEPFPEGFSKPAEFTQHKFVKICMEEPRFQANF
PQTWLWISGPLCLYCAERLYRYIRSNKPVTIISVISHPSDVMEIRMVKENFKARPGQYITLHCPSVSALE
NHPFTLTMCPTETKATFGVHLKIVGDWTERFRDLLLPPSSQDSEILPFIQSRNYPKLYIDGPFGSPFEES
LNYEVSLCVAGGIGVTPFASILNTLLDDWKPYKLRRLYFIWVCRDIQSFRWFADLLCMLHNKFWQENRPD
YVNIQLYLSQTDGIQKIIGEKYHALNSRLFIGRPRWKLLFDEIAKYNRGKTVGVFCCGPNSLSKTLHKLS
NQNNSYGTRFEYNKESFS

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_016931
ORF Size 1734 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_016931.4
RefSeq Size 2416 bp
RefSeq ORF 1737 bp
Locus ID 50507
UniProt ID Q9NPH5
Cytogenetics 11q14.3
Protein Families Druggable Genome, Transmembrane
Summary This gene encodes a member of the NOX-family of enzymes that functions as the catalytic subunit the NADPH oxidase complex. The encoded protein is localized to non-phagocytic cells where it acts as an oxygen sensor and catalyzes the reduction of molecular oxygen to various reactive oxygen species (ROS). The ROS generated by this protein have been implicated in numerous biological functions including signal transduction, cell differentiation and tumor cell growth. A pseudogene has been identified on the other arm of chromosome 11. Alternative splicing results in multiple transcript variants.provided by RefSeq, Jan 2009
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_016931" in other vectors (7)
SKU Description Size Price
RC208007 NOX4 (Myc-DDK-tagged)-Human NADPH oxidase 4 (NOX4), transcript variant 1 10 ug
$289.00 $538.00
RC208007L1 Lenti ORF clone of Human NADPH oxidase 4 (NOX4), transcript variant 1, Myc-DDK-tagged 10 ug
$838.00
RC208007L2 Lenti ORF clone of Human NADPH oxidase 4 (NOX4), transcript variant 1, mGFP tagged 10 ug
$838.00
RC208007L3 Lenti ORF clone of Human NADPH oxidase 4 (NOX4), transcript variant 1, Myc-DDK-tagged 10 ug
$838.00
RC208007L4 Lenti ORF clone of Human NADPH oxidase 4 (NOX4), transcript variant 1, mGFP tagged 10 ug
$838.00
SC310253 NOX4 (untagged)-Human NADPH oxidase 4 (NOX4), transcript variant 1 10 ug
$808.00
SC322623 NOX4 (untagged)-Human NADPH oxidase 4 (NOX4), transcript variant 1 10 ug
$808.00

Plasmid Map for RG208007

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RG208007
Circular map for RG208007

file-alt Citations

NOX4 promotes ferroptosis of astrocytes by oxidative stress-induced lipid peroxidation via the impairment of mitochondrial metabolism in Alzheimer's diseases
Park, Cha, Kim et al
Redox Biol (2021) 41, 101947 DOI: 10.1016/j.redox.2021.101947
Cited by 677
AI Summary: OriGene products pCMV6-AC-GFP-NOX4 (RG208007) and pCMV6-AC-GFP vector (PS100010) were used to overexpress human NOX4 in astrocytes, enabling the study of NOX4’s role in mitochondrial dysfunction and ferroptosis in Alzheimer’s disease.
Snippet: … For overexpression of human NOX4, Human astrocytes were seeded and transduced with pCMV6-AC-GFP constructs against human NOX4 (NM_016931) (RG208007, Origene, Rockville, MD, USA) or pCMV6-AC-GFP vector (PS100010, Origene). 2.5 Immunofluorescence analysis For immunofluorescence analysis, brain tissues were sectioned from paraffin embedded tissue bl;Human astrocytes were seeded and transduced with pCMV6-AC-GFP constructs against human NOX4 (NM_016931) (RG208007, Origene, Rockville, MD, USA) or pCMV6-AC-GFP vector (PS100010, Origene)
NADPH Oxidase 4 Induces Cardiac Arrhythmic Phenotype in Zebrafish
Zhang, Shimizu, Siu et al
J. Biol. Chem. (2014)
AI Summary: OriGene’s pCMV6-hNOX4 plasmid (#SC310253) was used as the template to amplify the human NOX4 gene for overexpression studies in zebrafish, enabling the investigation of NOX4’s role in inducing cardiac arrhythmia.
Snippet: EXPERIMENTAL PROCECURES Cloning and in vitro RNA transcription - Human NOX4 (NM_016931) full-length coding region was amplified from pCMV6-hNOX4 (OriGene, #SC310253, Rockville, MD) by PCR and cloned into pCS2+ at Cla I and Xho I sites. ... Cite SaveSaving
miR‐9‐5p suppresses pro‐fibrogenic transformation of fibroblasts and prevents organ fibrosis by targeting NOX4 and TGFBR2
Fierro‐Fernández, Ó Busnadiego
EMBO Reports (2015) 16, 1358–1377
AI Summary: OriGene products, specifically the pCMV5-NOX4 expression vector and the pCMV6-AC-GFP empty vector, were used in this study to manipulate gene expression and investigate the roles of NOX4 and TGFBR2 in fibroblast transformation and organ fibrosis.
Snippet: Biológicas, CSIC, Madrid, Spain). An expression vector containing the human NOX4 open reading frame (pCMV5-NOX4) was purchased from Origene (Rockville, MD). The pCMV6-AC-GFP empty vector was also purchased from Origene (Rockville, MD). The efficiency of transfection was ~20–30%. The over-expression of TGFBR2 and NOX4 was confirmed by qRT–PCR
Showing 1-3 of 3 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products