MAP1LC3A (NM_032514) Human Tagged ORF Clone

  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

SKU
RG202222
MAP1LC3A (tGFP-tagged) - Human microtubule-associated protein 1 light chain 3 alpha (MAP1LC3A), transcript variant 1
$489.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol MAP1LC3A
Synonyms ATG8E; LC3; LC3A; MAP1ALC3; MAP1BLC3
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG202222 representing NM_032514
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCCTCAGACCGGCCTTTCAAGCAGCGGCGGAGCTTCGCCGACCGCTGTAAGGAGGTACAGCAGATCC
GCGACCAGCACCCCAGCAAAATCCCGGTGATCATCGAGCGCTACAAGGGTGAGAAGCAGCTGCCCGTCCT
GGACAAGACCAAGTTTTTGGTCCCGGACCATGTCAACATGAGCGAGTTGGTCAAGATCATCCGGCGCCGC
CTGCAGCTGAACCCCACGCAGGCCTTCTTCCTGCTGGTGAACCAGCACAGCATGGTGAGTGTGTCCACGC
CCATCGCGGACATCTACGAGCAGGAGAAAGACGAGGACGGCTTCCTCTATATGGTCTACGCCTCCCAGGA
AACCTTCGGCTTC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG202222 representing NM_032514
Red=Cloning site Green=Tags(s)

MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRR
LQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_032514
ORF Size 363 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_032514.4
RefSeq Size 1030 bp
RefSeq ORF 366 bp
Locus ID 84557
UniProt ID Q9H492
Cytogenetics 20q11.22
Domains MAP1_LC3
Summary MAP1A and MAP1B are microtubule-associated proteins which mediate the physical interactions between microtubules and components of the cytoskeleton. MAP1A and MAP1B each consist of a heavy chain subunit and multiple light chain subunits. The protein encoded by this gene is one of the light chain subunits and can associate with either MAP1A or MAP1B. Two transcript variants encoding different isoforms have been found for this gene. The expression of variant 1 is suppressed in many tumor cell lines, suggesting that may be involved in carcinogenesis. [provided by RefSeq, Feb 2012]
 
 
 
 
 
Be the first to review this product
SKU Description Size Price
RC202222 MAP1LC3A (Myc-DDK-tagged)-Human microtubule-associated protein 1 light chain 3 alpha (MAP1LC3A), transcript variant 1 10 ug
$289.00
RC202222L1 Lenti ORF clone of Human microtubule-associated protein 1 light chain 3 alpha (MAP1LC3A), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC202222L2 Lenti ORF clone of Human microtubule-associated protein 1 light chain 3 alpha (MAP1LC3A), transcript variant 1, mGFP tagged 10 ug
$450.00
RC202222L3 Lenti ORF clone of Human microtubule-associated protein 1 light chain 3 alpha (MAP1LC3A), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC202222L4 Lenti ORF clone of Human microtubule-associated protein 1 light chain 3 alpha (MAP1LC3A), transcript variant 1, mGFP tagged 10 ug
$450.00
SC111851 MAP1LC3A (untagged)-Human microtubule-associated protein 1 light chain 3 alpha (MAP1LC3A), transcript variant 1 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.