MAP1LC3A (NM_032514) Human Tagged ORF Clone
SKU
RC202222
MAP1LC3A (Myc-DDK-tagged)-Human microtubule-associated protein 1 light chain 3 alpha (MAP1LC3A), transcript variant 1
-
TrueORF®
TrueORF®
Expression-ready ORF plasmid with C-terminal tag(s)
Click here to learn more.
Product Data | |
Type | Human Tagged ORF Clone |
---|---|
Target Symbol | MAP1LC3A |
Synonyms | ATG8E; LC3; LC3A; MAP1ALC3; MAP1BLC3 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
ORF Nucleotide Sequence
>RC202222 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCCCTCAGACCGGCCTTTCAAGCAGCGGCGGAGCTTCGCCGACCGCTGTAAGGAGGTACAGCAGATCC GCGACCAGCACCCCAGCAAAATCCCGGTGATCATCGAGCGCTACAAGGGTGAGAAGCAGCTGCCCGTCCT GGACAAGACCAAGTTTTTGGTCCCGGACCATGTCAACATGAGCGAGTTGGTCAAGATCATCCGGCGCCGC CTGCAGCTGAACCCCACGCAGGCCTTCTTCCTGCTGGTGAACCAGCACAGCATGGTGAGTGTGTCCACGC CCATCGCGGACATCTACGAGCAGGAGAAAGACGAGGACGGCTTCCTCTATATGGTCTACGCCTCCCAGGA AACCTTCGGCTTC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC202222 protein sequence
Red=Cloning site Green=Tags(s) MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRR LQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF myc-FLAG tag |
Chromatograms |
Chromatograms
![]() Sequencher program is needed, download here |
Restriction Sites |
SgfI-MluI Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_032514 |
ORF Size | 363 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution Method | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Shipping | Ambient |
Reference Data | |
RefSeq | NM_032514.4 |
RefSeq Size | 1048 bp |
RefSeq ORF | 366 bp |
Locus ID | 84557 |
UniProt ID | Q9H492 |
Cytogenetics | 20q11.22 |
Domains | MAP1_LC3 |
MW | 14.3 kDa |
Summary | MAP1A and MAP1B are microtubule-associated proteins which mediate the physical interactions between microtubules and components of the cytoskeleton. MAP1A and MAP1B each consist of a heavy chain subunit and multiple light chain subunits. The protein encoded by this gene is one of the light chain subunits and can associate with either MAP1A or MAP1B. Two transcript variants encoding different isoforms have been found for this gene. The expression of variant 1 is suppressed in many tumor cell lines, suggesting that may be involved in carcinogenesis. [provided by RefSeq, Feb 2012] |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
SKU | Description | Size | Price | |
---|---|---|---|---|
RC202222L1 | Lenti ORF clone of Human microtubule-associated protein 1 light chain 3 alpha (MAP1LC3A), transcript variant 1, Myc-DDK-tagged | 10 ug |
$450.00
|
|
RC202222L2 | Lenti ORF clone of Human microtubule-associated protein 1 light chain 3 alpha (MAP1LC3A), transcript variant 1, mGFP tagged | 10 ug |
$450.00
|
|
RC202222L3 | Lenti ORF clone of Human microtubule-associated protein 1 light chain 3 alpha (MAP1LC3A), transcript variant 1, Myc-DDK-tagged | 10 ug |
$450.00
|
|
RC202222L4 | Lenti ORF clone of Human microtubule-associated protein 1 light chain 3 alpha (MAP1LC3A), transcript variant 1, mGFP tagged | 10 ug |
$450.00
|
|
RG202222 | MAP1LC3A (tGFP-tagged) - Human microtubule-associated protein 1 light chain 3 alpha (MAP1LC3A), transcript variant 1 | 10 ug |
$489.00
|
|
SC111851 | MAP1LC3A (untagged)-Human microtubule-associated protein 1 light chain 3 alpha (MAP1LC3A), transcript variant 1 | 10 ug |
$150.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.