OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

EZH2 (NM_004456) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC202054
EZH2 (Myc-DDK-tagged)-Human enhancer of zeste homolog 2 (Drosophila) (EZH2), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $1,031.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA802907 EZH2 mouse monoclonal antibody, clone OTI2B10 (formerly 2B10) 100 ul
$447.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "EZH2 or NM_004456"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol EZH2
Synonyms ENX-1; ENX1; EZH2b; KMT6; KMT6A; WVS; WVS2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202054 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCCAGACTGGGAAGAAATCTGAGAAGGGACCAGTTTGTTGGCGGAAGCGTGTAAAATCAGAGTACA
TGCGACTGAGACAGCTCAAGAGGTTCAGACGAGCTGATGAAGTAAAGAGTATGTTTAGTTCCAATCGTCA
GAAAATTTTGGAAAGAACGGAAATCTTAAACCAAGAATGGAAACAGCGAAGGATACAGCCTGTGCACATC
CTGACTTCTGTGAGCTCATTGCGCGGGACTAGGGAGTGTTCGGTGACCAGTGACTTGGATTTTCCAACAC
AAGTCATCCCATTAAAGACTCTGAATGCAGTTGCTTCAGTACCCATAATGTATTCTTGGTCTCCCCTACA
GCAGAATTTTATGGTGGAAGATGAAACTGTTTTACATAACATTCCTTATATGGGAGATGAAGTTTTAGAT
CAGGATGGTACTTTCATTGAAGAACTAATAAAAAATTATGATGGGAAAGTACACGGGGATAGAGAATGTG
GGTTTATAAATGATGAAATTTTTGTGGAGTTGGTGAATGCCCTTGGTCAATATAATGATGATGACGATGA
TGATGATGGAGACGATCCTGAAGAAAGAGAAGAAAAGCAGAAAGATCTGGAGGATCACCGAGATGATAAA
GAAAGCCGCCCACCTCGGAAATTTCCTTCTGATAAAATTTTTGAAGCCATTTCCTCAATGTTTCCAGATA
AGGGCACAGCAGAAGAACTAAAGGAAAAATATAAAGAACTCACCGAACAGCAGCTCCCAGGCGCACTTCC
TCCTGAATGTACCCCCAACATAGATGGACCAAATGCTAAATCTGTTCAGAGAGAGCAAAGCTTACACTCC
TTTCATACGCTTTTCTGTAGGCGATGTTTTAAATATGACTGCTTCCTACATCGTAAGTGCAATTATTCTT
TTCATGCAACACCCAACACTTATAAGCGGAAGAACACAGAAACAGCTCTAGACAACAAACCTTGTGGACC
ACAGTGTTACCAGCATTTGGAGGGAGCAAAGGAGTTTGCTGCTGCTCTCACCGCTGAGCGGATAAAGACC
CCACCAAAACGTCCAGGAGGCCGCAGAAGAGGACGGCTTCCCAATAACAGTAGCAGGCCCAGCACCCCCA
CCATTAATGTGCTGGAATCAAAGGATACAGACAGTGATAGGGAAGCAGGGACTGAAACGGGGGGAGAGAA
CAATGATAAAGAAGAAGAAGAGAAGAAAGATGAAACTTCGAGCTCCTCTGAAGCAAATTCTCGGTGTCAA
ACACCAATAAAGATGAAGCCAAATATTGAACCTCCTGAGAATGTGGAGTGGAGTGGTGCTGAAGCCTCAA
TGTTTAGAGTCCTCATTGGCACTTACTATGACAATTTCTGTGCCATTGCTAGGTTAATTGGGACCAAAAC
ATGTAGACAGGTGTATGAGTTTAGAGTCAAAGAATCTAGCATCATAGCTCCAGCTCCCGCTGAGGATGTG
GATACTCCTCCAAGGAAAAAGAAGAGGAAACACCGGTTGTGGGCTGCACACTGCAGAAAGATACAGCTGA
AAAAGGACGGCTCCTCTAACCATGTTTACAACTATCAACCCTGTGATCATCCACGGCAGCCTTGTGACAG
TTCGTGCCCTTGTGTGATAGCACAAAATTTTTGTGAAAAGTTTTGTCAATGTAGTTCAGAGTGTCAAAAC
CGCTTTCCGGGATGCCGCTGCAAAGCACAGTGCAACACCAAGCAGTGCCCGTGCTACCTGGCTGTCCGAG
AGTGTGACCCTGACCTCTGTCTTACTTGTGGAGCCGCTGACCATTGGGACAGTAAAAATGTGTCCTGCAA
GAACTGCAGTATTCAGCGGGGCTCCAAAAAGCATCTATTGCTGGCACCATCTGACGTGGCAGGCTGGGGG
ATTTTTATCAAAGATCCTGTGCAGAAAAATGAATTCATCTCAGAATACTGTGGAGAGATTATTTCTCAAG
ATGAAGCTGACAGAAGAGGGAAAGTGTATGATAAATACATGTGCAGCTTTCTGTTCAACTTGAACAATGA
TTTTGTGGTGGATGCAACCCGCAAGGGTAACAAAATTCGTTTTGCAAATCATTCGGTAAATCCAAACTGC
TATGCAAAAGTTATGATGGTTAACGGTGATCACAGGATAGGTATTTTTGCCAAGAGAGCCATCCAGACTG
GCGAAGAGCTGTTTTTTGATTACAGATACAGCCAGGCTGATGCCCTGAAGTATGTCGGCATCGAAAGAGA
AATGGAAATCCCT

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC202054 protein sequence
Red=Cloning site Green=Tags(s)

MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEWKQRRIQPVHI
LTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLD
QDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQYNDDDDDDDGDDPEEREEKQKDLEDHRDDK
ESRPPRKFPSDKIFEAISSMFPDKGTAEELKEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHS
FHTLFCRRCFKYDCFLHRKCNYSFHATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKT
PPKRPGGRRRGRLPNNSSRPSTPTINVLESKDTDSDREAGTETGGENNDKEEEEKKDETSSSSEANSRCQ
TPIKMKPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPAPAEDV
DTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSECQN
RFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVSCKNCSIQRGSKKHLLLAPSDVAGWG
IFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNC
YAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYSQADALKYVGIEREMEIP

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_004456
ORF Size 2253 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004456.5
RefSeq Size 2723 bp
RefSeq ORF 2256 bp
Locus ID 2146
UniProt ID Q15910
Cytogenetics 7q36.1
Domains myb_DNA-binding, SET
Protein Families Druggable Genome, Transcription Factors
MW 86 kDa
Summary This gene encodes a member of the Polycomb-group (PcG) family. PcG family members form multimeric protein complexes, which are involved in maintaining the transcriptional repressive state of genes over successive cell generations. This protein associates with the embryonic ectoderm development protein, the VAV1 oncoprotein, and the X-linked nuclear protein. This protein may play a role in the hematopoietic and central nervous systems. Multiple alternatively splcied transcript variants encoding distinct isoforms have been identified for this gene. provided by RefSeq, Feb 2011
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_004456" in other vectors (6)
SKU Description Size Price
RC202054L1 Lenti ORF clone of Human enhancer of zeste homolog 2 (Drosophila) (EZH2), transcript variant 1, Myc-DDK-tagged 10 ug
$1,331.00
RC202054L2 Lenti ORF clone of Human enhancer of zeste homolog 2 (Drosophila) (EZH2), transcript variant 1, mGFP tagged 10 ug
$1,331.00
RC202054L3 Lenti ORF clone of Human enhancer of zeste homolog 2 (Drosophila) (EZH2), transcript variant 1, Myc-DDK-tagged 10 ug
$1,331.00
RC202054L4 Lenti ORF clone of Human enhancer of zeste homolog 2 (Drosophila) (EZH2), transcript variant 1, mGFP tagged 10 ug
$1,331.00
RG202054 EZH2 (tGFP-tagged) - Human enhancer of zeste homolog 2 (Drosophila) (EZH2), transcript variant 1 10 ug
$789.00 $1,231.00
SC128144 EZH2 (untagged)-Human enhancer of zeste homolog 2 (Drosophila) (EZH2), transcript variant 1 10 ug
$1,033.00

Plasmid Map for RC202054

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC202054
Circular map for RC202054

file-alt Citations

The pattern of histone H3 epigenetic posttranslational modifications is regulated by the VRK1 chromatin kinase
Monte-Serrano, Morejón-García, Campillo-Marcos et al
Epigenetics Chromatin (2023) 16 (1), 18 DOI: 10.1186/s13072-023-00494-7
Cited by 15
AI Summary: In this study, OriGene’s pCMV6-Myc-DDK plasmids for EZH2 (#RC202054) and KDM1A/LSD1 (#RC208480) were used to express these epigenetic regulators in mammalian cells, enabling investigation of their roles in VRK1-mediated histone H3 modifications.
Snippet: … Table 2Plasmids PROTEIN OR TAG PLASMID TAG EXPRESSION SUPPLIER, REFERENCE EZH2 pCMV6 Myc-DDK Mammalian Origene, #RC202054 Flag-Ø pCEFL Flag Mammalian Gift from JS Gutkind (NIH) GST-Ø pGEX-2TK GST Bacterial GE Healthcare GE28-9546-53 HA-Ø pCEFL HA Mammalian Gift from;EZH2 pCMV6 Myc-DDK Mammalian Origene, #RC202054 Flag-Ø pCEFL Flag Mammalian Gift from JS Gutkind (NIH) GST-Ø pGEX-2TK GST Bacterial GE Healthcare GE28-9546-53 HA-Ø pCEFL HA Mammalian Gift from JS Gutkind (NIH) HDAC1 pcDNA3.1+ Flag Mammalian Addgene, #13820 KDM1A (LSD1) pCMV6 Myc-DDK Mammalian Origene, #RC208480
FigureFigureFigure
Angioplasty induces epigenomic remodeling in injured arteries
Zhang, Urabe, Ozer et al
Life Sci Alliance (2022) 5 (5) DOI: 10.26508/lsa.202101114
Cited by 9
AI Summary: OriGene’s EZH1 (Cat. no. RC202367) and EZH2 (Cat. no. RC202054) cDNA clones were used to enable overexpression studies, facilitating investigation of epigenetic regulators in injured arteries.
Snippet: …For EZH overexpression, EZH1 and EZH2 cDNA clones were purchased from Origene (Cat. … RC202367 and Cat. … RC202054). Lenti-EZH1-GFP and Lenti-EZH2-GFP were constructed based on these cDNA clones using a GFP-expressing lenti-vector as we previously described (Zhang e;EZH1 and EZH2 cDNA clones were purchased from Origene (Cat. … RC202367 and Cat. … RC202054)
EZH2 regulates expression of FOXC1 by mediating H3K27me3 in breast cancers
Zheng, Li, Yi et al
Acta Pharmacol Sin (2020)
Cited by 21
AI Summary: OriGene’s EZH2 expression plasmids and empty vector were used to transfect HCC1806 breast cancer cells, enabling the study to assess how EZH2 regulates FOXC1 expression via H3K27me3 modification.
Snippet: HCC1806 cells, which have low EZH2 expression, were cultured in 60-mm dishes to 75%–85% confluence for 24 h before transfection. Cells were then transfected with EZH2 expression plasmids (OriGene, Rockville, MD, USA) or an empty vector (OriGene,
WB IHC
Disruption of FOXP3-EZH2 Interaction Represents a Pathobiological Mechanism in Intestinal Inflammation
Bamidele, Svingen, Sagstetter et al
Cell Mol Gastroenterol Hepatol (2019) 7 (1), 55-71 DOI: 10.1016/j.jcmgh.2018.08.009
AI Summary: In this study, OriGene’s myc–DDK–tagged human EZH2 plasmid (cat. RC202054) was used to investigate the interaction between EZH2 and FOXP3, helping to elucidate molecular mechanisms underlying intestinal inflammation.
Snippet: OXP3 DNA then was cloned into pCDNA3.1–His–tagged vector plasmid to generate a fusion of His-tagged FOXP3 (pCDNA3.1–His–FOXP3). Fusion plasmid myc–DDK–tagged human EZH2 was obtained from Origene (cat. RC202054, Rockville, MD), whereas myc–His–tagged human EZH2 was a kind gift from Mien-Chie Hung. The human IL2 luciferase reporter was purchased from Affymetrix (cat. LR1014). Flow
FigureFigureFigure
Repression of PDK1- and LncRNA HOTAIR-Mediated EZH2 Gene Expression Contributes to the Enhancement of Atractylenolide 1 and Erlotinib in the Inhibition of Human Lung Cancer Cells
Xiao, Zheng, Tang et al
Cell. Physiol. Biochem. (2018) 49 (4), 1615-1632 DOI: 10.1159/000493497
AI Summary: OriGene products, specifically the Myc/FLAG-tagged human PDK1 and EZH2 expression constructs (pCMV6 vectors) and the pcDNA 3.1-HOTAIR plasmid, were used to overexpress PDK1, EZH2, and HOTAIR in lung cancer cells, enabling the study of their roles in the inhibitory effects of atractylenolide 1 and erlotinib on tumor growth.
Snippet: In the separated experiment, 2 µg of control (pCMV6) and the expression constructs containing Myc/FLAG-tagged ORFs of human PDK1 and EZH2, and control (pcDNA3.1) or pcDNA 3.1-HOTAIR obtained from OriGene Technologies, Inc
Disruption of FOXP3–EZH2 Interaction Represents a Pathobiological Mechanism in Intestinal Inflammation
Bamidele, Svingen, Sagstetter et al
Cellular and Molecular Gastroenterology and Hepatology (2018)
AI Summary: OriGene provided the myc–DDK–tagged human EZH2 plasmid (cat. RC202054), which was used in the study to investigate the molecular interactions underlying intestinal inflammation.
Snippet: Fusion plasmid myc–DDK–tagged human EZH2 was obtained from Origene (cat. RC202054), whereas myc–His–tagged human EZH2 was a kind gift from Mien-Chie Hung. The human IL2 luciferase reporter was purchased from Affymetrix (cat. LR1014)
Showing 1-6 of 13 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products