OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Gata2 (NM_008090) Mouse Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
MR226728
Gata2 (Myc-DDK-tagged) - Mouse GATA binding protein 2 (Gata2)
Interest in protein/lysate? Submit request here!
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Gata2 or NM_008090"

Specifications
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Gata2
Synonyms Gata-2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR226728 representing NM_008090
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGTGGCGCCTGAGCAGCCTCGCTGGATGGCGCACCCCGCCGTATTGAATGCGCAGCACCCCGACT
CGCACCATCCGGGCCTGGCGCATAACTACATGGAGCCAGCACAGCTGCTGCCTCCCGACGAGGTGGATGT
CTTCTTCAACCATCTCGACTCGCAGGGCAACCCTTACTACGCCAACCCGGCCCACGCGCGCGCGCGCGTT
TCCTACAGCCCGGCGCATGCCCGTCTCACCGGAGGCCAGATGTGCCGACCACACTTGTTGCACAGCCCAG
GCTTGCCGTGGCTGGACGGGGGCAAAGCAGCTCTCTCTGCCGCCGCTGCCCATCACCACAGTCCCTGGAC
CGTCAGCCCGTTCTCCAAGACCCCGCTGCACCCCTCAGCTGCTGGAGCACCCGGAGGGCCTCTGTCTGTT
TACCCAGGGGCTGCGGGTGGGAGCGGGGGAGGCAGTGGGAGCTCCGTGGCCTCCCTCACCCCCACTGCAG
CCCACTCGGGCTCCCATCTCTTCGGCTTCCCACCCACGCCACCCAAAGAAGTGTCTCCAGACCCCAGCAC
AACAGGAGCTGCTTCCCCGGCCTCTTCTTCTGCAGGGGGTAGTGTAGCCCGGGGTGAGGACAAGGATGGC
GTCAAGTACCAAGTGTCACTCTCCGAGAGCATGAAGATGGAAGGCGGCAGTCCCCTGCGCCCGGGCCTAG
CTACCATGGGCACCCAGCCTGCAACACACCACCCGATACCCACCTATCCCTCCTATGTGCCCGCCGCAGC
TCATGACTATGGCAGCAGTCTCTTCCATCCAGGAGGCTTCCTGGGTGGCCCCGCCTCCAGCTTCACCCCT
AAGCAGAGAAGCAAGGCTCGCTCCTGCTCAGAAGGCCGGGAGTGTGTCAACTGTGGTGCCACAGCCACCC
CTCTCTGGCGACGAGATGGCACGGGCCACTACCTGTGCAATGCCTGTGGGCTCTACCACAAGATGAATGG
ACAGAACCGGCCGCTCATCAAGCCCAAGCGGAGGCTGTCTGCTGCCAGAAGAGCGGGCACCTGTTGTGCA
AATTGTCAGACGACAACCACCACCTTATGGCGCCGGAACGCCAACGGGGACCCTGTGTGCAACGCCTGTG
GCCTCTACTACAAGCTGCACAATGTTAACAGGCCACTGACCATGAAGAAGGAAGGGATCCAGACCCGGAA
TCGGAAGATGTCCAGCAAATCCAAGAAGAGCAAGAAAGGGGCTGAATGTTTCGAGGAGCTCTCCAAGTGC
ATGCAAGAGAAGTCACCGCCCTTCAGTGCGGCTGCCCTGGCTGGACACATGGCACCTGTGGGACACCTCC
CACCTTTTAGTCACTCTGGACACATCCTACCCACGCCCACGCCTATCCACCCTTCCTCCAGTCTCTCTTT
TGGCCACCCCCACCCGTCCAGCATGGTGACTGCCATGGGC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR226728 representing NM_008090
Red=Cloning site Green=Tags(s)

MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEVDVFFNHLDSQGNPYYANPAHARARV
SYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHSPWTVSPFSKTPLHPSAAGAPGGPLSV
YPGAAGGSGGGSGSSVASLTPTAAHSGSHLFGFPPTPPKEVSPDPSTTGAASPASSSAGGSVARGEDKDG
VKYQVSLSESMKMEGGSPLRPGLATMGTQPATHHPIPTYPSYVPAAAHDYGSSLFHPGGFLGGPASSFTP
KQRSKARSCSEGRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCA
NCQTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNRKMSSKSKKSKKGAECFEELSKC
MQEKSPPFSAAALAGHMAPVGHLPPFSHSGHILPTPTPIHPSSSLSFGHPHPSSMVTAMG

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_008090
ORF Size 1440 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_008090.5, NP_032116.4
RefSeq Size 3258 bp
RefSeq ORF 1443 bp
Locus ID 14461
UniProt ID O09100
Cytogenetics 6 39.2 cM
MW 50.9 kDa
Summary Transcriptional activator which regulates endothelin-1 gene expression in endothelial cells. Binds to the consensus sequence 5'-AGATAG-3'.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_008090" in other vectors (4)
SKU Description Size Price
MC216629 Gata2 (untagged) - Mouse GATA binding protein 2 (Gata2), (10ug) 10 ug
$457.00
MG226728 Gata2 (tGFP-tagged) - Mouse GATA binding protein 2 (Gata2), (10ug) 10 ug
$657.00
MR226728L3 Lenti ORF clone of Gata2 (Myc-DDK-tagged) - Mouse GATA binding protein 2 (Gata2) 10 ug
$757.00
MR226728L4 Lenti ORF clone of Gata2 (mGFP-tagged) - Mouse GATA binding protein 2 (Gata2) 10 ug
$757.00

Plasmid Map for MR226728

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for MR226728
Circular map for MR226728

file-alt Citations

The Polycomb-Dependent Epigenome Controls β Cell Dysfunction, Dedifferentiation, and Diabetes
Lu, Heyne, Dror et al
Cell Metab. (2018) 27 (6), 1294-1308.e7 DOI: 10.1016/j.cmet.2018.04.013
AI Summary: OriGene’s mouse cDNA ORF clones for six different transcription factors were used to over-express these factors in Min6-B1 cells, enabling the study of their roles in β cell identity and dysfunction in the context of diabetes.
Snippet: Transcription Factor Over-Expression Min6-B1 cell line were electroporated using Nucleofector II device (Lonza, Kit T, Program O-017) with pMAXGFP (Lonza) or mouse cDNA ORF clones of the 6 different transcription factors (Origene). 4 days after electroporation, cells were harvested, trypsinized and single cells were sorted in 384-well plates containing 240 nL of primer mix and 1.2 μL of PCR encaps...
FigureFigureFigure
Differential effects on gene transcription and hematopoietic differentiation correlate with GATA2 mutant disease phenotypes
Chong, Venugopal, Stokes et al
Leukemia (2017)
AI Summary: OriGene products, specifically the human pCMV6-XL6-GATA2 and mouse pCMV6-Entry-GATA2 expression constructs, were used to generate GATA2 wild-type and mutant proteins for functional studies in this research.
Snippet: Human Research Ethics Committees. Constructs GATA2 expression constructs (human (h) pCMV6-XL6-GATA2 and mouse (m) pCMV6-Entry-GATA2) were purchased from OriGene (Rockville, MD, USA). A GATA2 mutant allelic ... All 4 versions Cite SaveSaving
重新编程的小鼠胚胎成纤维细胞转录因子诱导 Hemogenic 计划
Daniel, Pereira, Bernitz et al
JOVE (2016)
Snippet: Gelatin, Sigma, G-1890 100g, pFUW-tetO, Addgene, Plasmid #20321, Gata2, Origene, MR226728, Gfi1b, Origene, MR204861, cFos, Addgene, Plasmid #19259, Etv6, Origene, MR207053, psPAX2, Addgene, Plasmid #12260, pMD2.G, Addgene, Plasmid #12259, ... Cite SaveSaving
Showing 1-3 of 3 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products