OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TIFA (NM_052864) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC204357
TIFA (Myc-DDK-tagged)-Human TRAF-interacting protein with forkhead-associated domain (TIFA)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA360955 TIFA Antibody - middle region
100 ul
$585.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "TIFA or NM_052864"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TIFA
Synonyms T2BP; T6BP; TIFAA
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204357 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACCAGTTTTGAAGATGCTGACACAGAAGAGACAGTAACTTGTCTCCAGATGACGGTTTACCATCCTG
GCCAGTTGCAGTGTGGAATATTTCAGTCAATAAGTTTTAACAGAGAGAAACTCCCTTCCAGCGAAGTGGT
GAAATTTGGCCGAAATTCCAACATCTGTCATTATACTTTTCAGGACAAACAGGTTTCCCGAGTTCAGTTT
TCTCTGCAGCTGTTTAAAAAATTCAACAGCTCAGTTCTCTCCTTTGAAATAAAAAATATGAGTAAAAAGA
CCAATCTGATCGTGGACAGCAGAGAGCTGGGCTACCTAAATAAAATGGACCTGCCATACAGGTGCATGGT
CAGATTCGGAGAGTATCAGTTTCTGATGGAGAAGGAAGATGGCGAGTCATTGGAATTTTTTGAGACTCAA
TTTATTTTATCTCCAAGATCACTCTTGCAAGAAAACAACTGGCCACCACACAGGCCCATACCGGAGTATG
GCACTTACTCGCTCTGCTCCTCCCAAAGCAGTTCTCCGACAGAAATGGATGAAAATGAGTCA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC204357 protein sequence
Red=Cloning site Green=Tags(s)

MTSFEDADTEETVTCLQMTVYHPGQLQCGIFQSISFNREKLPSSEVVKFGRNSNICHYTFQDKQVSRVQF
SLQLFKKFNSSVLSFEIKNMSKKTNLIVDSRELGYLNKMDLPYRCMVRFGEYQFLMEKEDGESLEFFETQ
FILSPRSLLQENNWPPHRPIPEYGTYSLCSSQSSSPTEMDENES

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_052864
ORF Size 552 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_052864.3
RefSeq Size 3090 bp
RefSeq ORF 555 bp
Locus ID 92610
UniProt ID Q96CG3
Cytogenetics 4q25
MW 21.4 kDa
Summary This gene encodes an adapter protein involved in adaptive and innate immunity. This protein includes a forkhead-associated (FHA) domain that specifically binds to phosphorylated serine and threonine residues. In response to bacterial infection, the encoded host cell protein undergoes an intermolecular interaction between the FHA domain and a phosphorylated threonine that leads to protein oligomerization and stimulation of the NF-kappa B and other downstream signaling pathways. This protein exhibits reduced expression in hepatocellular carcinoma and may suppress hepatocellular carcinoma progression. This protein may also play a role in the DNA damage response. provided by RefSeq, Jun 2018
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_052864" in other vectors (4)
SKU Description Size Price
RC204357L3 Lenti ORF clone of Human TRAF-interacting protein with forkhead-associated domain (TIFA), Myc-DDK-tagged 10 ug
$600.00
RC204357L4 Lenti ORF clone of Human TRAF-interacting protein with forkhead-associated domain (TIFA), mGFP tagged 10 ug
$600.00
RG204357 TIFA (tGFP-tagged) - Human TRAF-interacting protein with forkhead-associated domain (TIFA) 10 ug
$489.00 $500.00
SC107567 TIFA (untagged)-Human TRAF-interacting protein with forkhead-associated domain (TIFA) 10 ug
$300.00

Plasmid Map for RC204357

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC204357
Circular map for RC204357

file-alt Citations

Microbial metabolite drives ageing-related clonal haematopoiesis via ALPK1
Agarwal, Sampson, Hueneman et al
Nature (2025)
Cited by 48
AI Summary: OriGene’s human TIFA tagged ORF clone (NM_052864, RC204357) was used to generate TIFA-TdTomato fusion constructs, enabling the study of TIFA’s role in pre-leukaemic cell expansion in this research.
Snippet: FA C-terminally fused to TdTomato, TIFA from human TIFA tagged ORF clone (NM_052864, RC204357, Origene) was amplified and cloned into pTdTomato N1 (54642, Addgene). For expressing TIFA-TdTomato f
Helicobacter pylori regulates TIFA turnover in gastric epithelial cells
Sokolova, Maubach, Naumann
Eur J Cell Biol (2023) 102 (2), 151307 DOI: 10.1016/j.ejcb.2023.151307
Cited by 9
AI Summary: OriGene contributed pCMV vectors encoding human wild-type TIFA tagged with Myc-Flag (#RC204357) and its T9A and E178A mutants, which were used to study TIFA function and turnover in H. pylori-infected gastric epithelial cells.
Snippet: Scrambled siRNAs pool (DharmaconTM) was used as a control. pCMV vectors encoding the human wt TIFA tagged with Myc-Flag at the C-terminus (#RC204357;Origene;1 µg per 35-mm dish or 4 µg per 100-mm dish) and its T9A and E178A mutants
TIFA has dual functions in Helicobacter pylori-induced classical and alternative NF-κB pathways
Maubach, Lim, Sokolova et al
EMBO Rep (2021)
Cited by 49
AI Summary: OriGene's wild-type human TIFA plasmid tagged with Myc-FLAG (catalog #RC204357) was used for rescue experiments to investigate TIFA's role in NF-κB pathway activation during Helicobacter pylori infection.
Snippet: Plasmids for rescue experiments were prepared using the Quik- Change II XL site-directed mutagenesis kit from Agilent Technolo- gies (#200521-5). The original plasmid containing wild-type human TIFA C-terminal tagged with Myc-FLAG (Origene, #RC204357) was
Helicobacter pylori modulates host cell responses by CagT4SS-dependent translocation of an intermediate metabolite of LPS inner core heptose biosynthesis
Stein, Faber, Bats et al
PLoS Pathog. (2017) 13 (7), e1006514 DOI: 10.1371/journal.ppat.1006514
AI Summary: OriGene contributed to this study by providing the CRISPR/Cas9 knockout kit (KN204357), which was used to generate TIFA knockout cell lines for investigating the role of TIFA in H. pylori-induced proinflammatory signaling.
Snippet: TIFA knockout cell lines were generated with a CRISPR/Cas9 kit from Origene (KN204357) that disrupts the TIFA gene by replacing the first 104 bases of the coding sequence including the start codon with a GFP-puromycin cassette
FigureFigureFigure
ALPK1 And TIFA Dependent Innate Immune Response Triggered By The Helicobacter Pylori Type IV Secretion System
Zimmermann, Pfannkuch, Al-Zeer et al
bioRxiv (2017)
Snippet: For overexpression of N - terminal wild type Myc - Flag - TIFA we used full length human TIFA 410 cDNA from Origene # RC204357 were we introduced a silent TGG to TCG point mutation encoding L103 411 to destroy the PAM site preventing CAS9 cutting of TIFA when overexpressed in TIFA deficient cells 412 (strain collection no. pMW930)
Showing 1-5 of 5 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products