alpha Synuclein (SNCA) (NM_000345) Human Recombinant Protein

CAT#: TP720923

Reviews ()
Write a review

Purified recombinant protein of Human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 1


Product Datasheet for 'TP720923'


  View other "SNCA" proteins (18)

USD 300.00


Availability*
2 Weeks

Size
    • 50 ug


Product images

Specifications

Product Data
Description Purified recombinant protein of Human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 1
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence GSHMDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Tag Tag Free
Predicted MW 14.7 kDa
Concentration Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Reference Data
RefSeq NP_000336
Locus ID 6622
Refseq Size 1543
Cytogenetics 4q22.1
Refseq ORF 420
Synonyms NACP; PARK1; PARK4; PD1
Summary Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease. Alternatively spliced transcripts encoding different isoforms have been identified for this gene. [provided by RefSeq, Feb 2016]
Protein Families Druggable Genome
Protein Pathways Alzheimer's disease, Parkinson's disease

Documents

Other Versions

Other products for "SNCA"
Frequently bought together (1)
SNCA mouse monoclonal antibody, clone OTI2F6 (formerly 2F6)
    • 100 ul

USD 379.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools
HUMAN PROREINS 101