alpha Synuclein (SNCA) (NM_001146054) Human Recombinant Protein
SKU
TP328735
Recombinant protein of human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 2, 20 µg
$867.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC228735 representing NM_001146054
Red=Cloning site Green=Tags(s) MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAV VTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 14.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001139526 |
Locus ID | 6622 |
UniProt ID | P37840 |
Cytogenetics | 4q22.1 |
RefSeq ORF | 420 |
Synonyms | NACP; PARK1; PARK4; PD1 |
Summary | Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease. Alternatively spliced transcripts encoding different isoforms have been identified for this gene. [provided by RefSeq, Feb 2016] |
Protein Families | Druggable Genome |
Protein Pathways | Alzheimer's disease, Parkinson's disease |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH310606 | SNCA MS Standard C13 and N15-labeled recombinant protein (NP_000336) | 10 ug |
$3,255.00
|
|
PH321446 | SNCA MS Standard C13 and N15-labeled recombinant protein (NP_009292) | 10 ug |
$3,255.00
|
|
LC400127 | SNCA HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC416080 | SNCA HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC431763 | SNCA HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC431764 | SNCA HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY400127 | Transient overexpression lysate of synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 1 | 100 ug |
$436.00
|
|
LY416080 | Transient overexpression lysate of synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 4 | 100 ug |
$436.00
|
|
LY431763 | Transient overexpression lysate of synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 2 | 100 ug |
$436.00
|
|
LY431764 | Transient overexpression lysate of synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 3 | 100 ug |
$436.00
|
|
TP310606 | Recombinant protein of human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant NACP140, 20 µg | 20 ug |
$867.00
|
|
TP321446 | Recombinant protein of human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant NACP112, 20 µg | 20 ug |
$867.00
|
|
TP328736 | Recombinant protein of human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 3, 20 µg | 20 ug |
$867.00
|
|
TP720923 | Purified recombinant protein of Human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 1 | 10 ug |
$155.00
|
|
TP721177 | Purified recombinant protein of Human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 1 | 10 ug |
$185.00
|
|
TP750040 | Purified recombinant protein of Human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 1, full length, Tag free, expressed in E. coli, 100ug | 100 ug |
$515.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.