alpha Synuclein (SNCA) (NM_007308) Human Mass Spec Standard

SKU
PH321446
SNCA MS Standard C13 and N15-labeled recombinant protein (NP_009292)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC221446]
Predicted MW 11.2 kDa
Protein Sequence
Protein Sequence
>RC221446 representing NM_007308
Red=Cloning site Green=Tags(s)

MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAV
VTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKEGYQDYEPEA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_009292
RefSeq Size 1096
RefSeq ORF 336
Synonyms NACP; PARK1; PARK4; PD1
Locus ID 6622
UniProt ID P37840
Cytogenetics 4q22.1
Summary Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease. Alternatively spliced transcripts encoding different isoforms have been identified for this gene. [provided by RefSeq, Feb 2016]
Protein Families Druggable Genome
Protein Pathways Alzheimer's disease, Parkinson's disease
Write Your Own Review
You're reviewing:alpha Synuclein (SNCA) (NM_007308) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH310606 SNCA MS Standard C13 and N15-labeled recombinant protein (NP_000336) 10 ug
$3,255.00
LC400127 SNCA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC416080 SNCA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431763 SNCA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431764 SNCA HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400127 Transient overexpression lysate of synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 1 100 ug
$436.00
LY416080 Transient overexpression lysate of synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 4 100 ug
$436.00
LY431763 Transient overexpression lysate of synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 2 100 ug
$436.00
LY431764 Transient overexpression lysate of synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 3 100 ug
$436.00
TP310606 Recombinant protein of human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant NACP140, 20 µg 20 ug
$867.00
TP321446 Recombinant protein of human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant NACP112, 20 µg 20 ug
$867.00
TP328735 Recombinant protein of human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 2, 20 µg 20 ug
$867.00
TP328736 Recombinant protein of human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 3, 20 µg 20 ug
$867.00
TP720923 Purified recombinant protein of Human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 1 10 ug
$155.00
TP721177 Purified recombinant protein of Human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 1 10 ug
$185.00
TP750040 Purified recombinant protein of Human synuclein, alpha (non A4 component of amyloid precursor) (SNCA), transcript variant 1, full length, Tag free, expressed in E. coli, 100ug 100 ug
$515.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.