OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ZFYVE27 (NM_001174120) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP329877
Purified recombinant protein of Homo sapiens zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 5, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA366222 ZFYVE27 rabbit polyclonal antibody
100 ul
$310.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "ZFYVE27 or NM_001174120"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC229877 representing NM_001174120
Red=Cloning site Green=Tags(s)

MQTSEREGSGPELSPSVMPEAPLESPPFPTKSPAFDLFNLVLSYKRLEIYLEPLKDAGDGVRYLLSLIQL
EAFLSRLCCTCEAAYRVLHWENPVVSSQFYGALLGTVCMLYLLPLCWVLTLLNSTLFLGNVEFFRVVSEY
RASLQQRMNPKQEEHAFESPPPPDVGGKDGLMDSTPALTPTEDLTPGSVEEAEEAEPDEEFKDAIEEDDE
GAPCPAEDELALQDNGFLSKNEVLRSKVSRLTERLRKRYPTNNFGNCTGCSATFSVLKKRRSCSNCGNSF
CSRCCSFKVPKSSMGATAPEAQRETVFVCASCNQTLSK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 35.7
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001167591
Locus ID 118813
UniProt ID Q5T4F4
Cytogenetics 10q24.2
RefSeq ORF 954
Synonyms PROTRUDIN; SPG33
Summary This gene encodes a protein with several transmembrane domains, a Rab11-binding domain and a lipid-binding FYVE finger domain. The encoded protein appears to promote neurite formation. A mutation in this gene has been reported to be associated with hereditary spastic paraplegia, however the pathogenicity of the mutation, which may simply represent a polymorphism, is unclear. provided by RefSeq, Mar 2010
Protein Categories Membrane Proteins, Nervous system Diseases
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "ZFYVE27" proteins (19)
SKU Description Size Price
PH306193 ZFYVE27 MS Standard C13 and N15-labeled recombinant protein (NP_653189) 10 ug
$3,360.00
PH319897 ZFYVE27 MS Standard C13 and N15-labeled recombinant protein (NP_001002261) 10 ug
$3,360.00
LC403394 Lyophilized ZFYVE27 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424194 Lyophilized ZFYVE27 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424195 Lyophilized ZFYVE27 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC432830 Lyophilized ZFYVE27 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC432865 Lyophilized ZFYVE27 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC432877 Lyophilized ZFYVE27 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC432956 Lyophilized ZFYVE27 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403394 Transient overexpression lysate of zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY424194 Transient overexpression lysate of zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 1 (as WB positive control) 100 ug
$665.00
LY424195 Transient overexpression lysate of zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY432830 Transient overexpression lysate of zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 7 (as WB positive control) 100 ug
$436.00
LY432865 Transient overexpression lysate of zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 6 (as WB positive control) 100 ug
$436.00
LY432877 Transient overexpression lysate of zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 5 (as WB positive control) 100 ug
$436.00
LY432956 Transient overexpression lysate of zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 4 (as WB positive control) 100 ug
$436.00
TP306193 Recombinant protein of human zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 2, 20 µg 20 ug
$867.00
TP319897 Recombinant protein of human zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 1, 20 µg 20 ug
$867.00
TP329865 Purified recombinant protein of Homo sapiens zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 6, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products