ZFYVE27 (NM_001174121) Human Recombinant Protein

SKU
TP329865
Purified recombinant protein of Homo sapiens zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 6, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC229865 representing NM_001174121
Red=Cloning site Green=Tags(s)

MISVPALLGYLQEVCRARLPDSELMRRKYHSVRQEDLQRGRLSRPEAVAEVKSFLIQLEAFLSRLCCTCE
AAYRVLHWENPVVSSQFYGALLGTVCMLYLLPLCWVLTLLNSTLFLGNVEFFRVVSEYRASLQQRMNPKQ
EEHAFESPPPPDVGGKDGLMDSTPALTPTESLSSQDLTPGSVEEAEEAEPDEEFKDAIEEDDEGAPCPAE
DELALQDNGFLSKNEVLRSKVSRLTERLRKRYPTNNFGNCTGCSATFSVLKKRRSCSNCGNSFCSRCCSF
KVPKSSMGATAPEAQRETVFVCASCNQTLSK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 35.1
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001167592
Locus ID 118813
UniProt ID Q5T4F4
Cytogenetics 10q24.2
RefSeq ORF 933
Synonyms PROTRUDIN; SPG33
Summary This gene encodes a protein with several transmembrane domains, a Rab11-binding domain and a lipid-binding FYVE finger domain. The encoded protein appears to promote neurite formation. A mutation in this gene has been reported to be associated with hereditary spastic paraplegia, however the pathogenicity of the mutation, which may simply represent a polymorphism, is unclear. [provided by RefSeq, Mar 2010]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:ZFYVE27 (NM_001174121) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH306193 ZFYVE27 MS Standard C13 and N15-labeled recombinant protein (NP_653189) 10 ug
$3,255.00
PH319897 ZFYVE27 MS Standard C13 and N15-labeled recombinant protein (NP_001002261) 10 ug
$3,255.00
LC403394 ZFYVE27 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC424194 ZFYVE27 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424195 ZFYVE27 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC432830 ZFYVE27 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC432865 ZFYVE27 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC432877 ZFYVE27 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC432956 ZFYVE27 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403394 Transient overexpression lysate of zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 2 100 ug
$436.00
LY424194 Transient overexpression lysate of zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 1 100 ug
$665.00
LY424195 Transient overexpression lysate of zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 3 100 ug
$436.00
LY432830 Transient overexpression lysate of zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 7 100 ug
$436.00
LY432865 Transient overexpression lysate of zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 6 100 ug
$436.00
LY432877 Transient overexpression lysate of zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 5 100 ug
$436.00
LY432956 Transient overexpression lysate of zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 4 100 ug
$436.00
TP306193 Recombinant protein of human zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP319897 Recombinant protein of human zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP329877 Purified recombinant protein of Homo sapiens zinc finger, FYVE domain containing 27 (ZFYVE27), transcript variant 5, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.